Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP1LC3A, Human (His)

MAP1LC3A is a key ubiquitin-like modifier essential for autophagosome vacuole formation, ensuring cellular homeostasis. As part of the GABARAP/GATE-16 subfamily, it plays a crucial role in late autophagosome maturation. MAP1LC3A Protein, Human (His) is the recombinant human-derived MAP1LC3A protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MAP1LC3A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/map1lc3a-protein-human-his.html

Smiles

MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

Molecular Formula

84557 (Gene_ID) Q9H492-1 (M1-F121) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Nitrosopyridine
MBS5801063 Inquire

2-Nitrosopyridine

Sign In for Pricing
View Details
Chiller, DuraChill CA,1/4HP (0.7kW), Positive Displacement Pump, 1/4HP, 240V, 50Hz
CA02A2P1-41AA1N 1 Each

Chiller, DuraChill CA,1/4HP (0.7kW), Positive Displacement Pump, 1/4HP, 240V, 50Hz

Sign In for Pricing
View Details
Rabbit Polyclonal Histone H4 [p Ser1] Antibody
NB21-2000 0.05 mg

Rabbit Polyclonal Histone H4 [p Ser1] Antibody

Sign In for Pricing
View Details
Mouse DLL1 Protein, His Tag
E40MOP1393 20 µg

Mouse DLL1 Protein, His Tag

Sign In for Pricing
View Details
40S Ribosomal Protein S4, X isoform (RPS4X)
303881-01 50 µL

40S Ribosomal Protein S4, X isoform (RPS4X)

Sign In for Pricing
View Details
40S Ribosomal Protein S4, X isoform (RPS4X)
303881-02 100 µL

40S Ribosomal Protein S4, X isoform (RPS4X)

Sign In for Pricing
View Details