Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein M/APOM, Human (HEK293, His)

Apolipoprotein M Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1]. The signal peptide is not cleaved and is required for ApoM association with lipoprotein particles as well as Megalin mediated reabsorption by the kidney. ApoM is cleared from the circulation by the ubiquitously expressed LDL R.

Product Specifications

Product Name Alternative

Apolipoprotein M/APOM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-m-protein-human-hek293-his.html

Purity

98.0

Smiles

CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Molecular Formula

55937 (Gene_ID) O95445-1 (M1-N188) (Accession)

Molecular Weight

19-24 kDa

References & Citations

[1]LaDu MJ, et al. Self-assembly of HEK cell-secreted ApoE particles resembles ApoE enrichment of lipoproteins as a ligand for the LDL receptor-related protein. Biochemistry. 2006 Jan 17;45 (2) :381-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL7AP59 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1887208 1.0 µg DNA

RPL7AP59 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human PSB4 ELISA Kit
E105095 1 Each

Human PSB4 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal gp96/HSP90B1/GRP94 Antibody (2H3) [Alexa Fluor 594]
NBP1-04346AF594 0.1 mL

Mouse Monoclonal gp96/HSP90B1/GRP94 Antibody (2H3) [Alexa Fluor 594]

Sign In for Pricing
View Details
Tetramethylthiuram disulfide
sc-258239A 100 g

Tetramethylthiuram disulfide

Sign In for Pricing
View Details
Rat Monoclonal Ly-6G/Ly-6C Antibody (RM0064-6D17) [Alexa Fluor 405]
NBP2-11784AF405 0.1 mL

Rat Monoclonal Ly-6G/Ly-6C Antibody (RM0064-6D17) [Alexa Fluor 405]

Sign In for Pricing
View Details
UNC5B (Protein Unc-5 Homolog B, Netrin Receptor UNC5B, Protein Unc-5 Homolog 2, UNC5H2, p53-regulated Receptor for Death and Life Protein 1, P53RDL1, UNQ1883/PRO4326)
MBS645789-01 0.1 mg

UNC5B (Protein Unc-5 Homolog B, Netrin Receptor UNC5B, Protein Unc-5 Homolog 2, UNC5H2, p53-regulated Receptor for Death and Life Protein 1, P53RDL1, UNQ1883/PRO4326)

Sign In for Pricing
View Details