Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein M/APOM, Human (HEK293, His)

Apolipoprotein M Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1]. The signal peptide is not cleaved and is required for ApoM association with lipoprotein particles as well as Megalin mediated reabsorption by the kidney. ApoM is cleared from the circulation by the ubiquitously expressed LDL R.

Product Specifications

Product Name Alternative

Apolipoprotein M/APOM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-m-protein-human-hek293-his.html

Purity

98.0

Smiles

CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Molecular Formula

55937 (Gene_ID) O95445-1 (M1-N188) (Accession)

Molecular Weight

19-24 kDa

References & Citations

[1]LaDu MJ, et al. Self-assembly of HEK cell-secreted ApoE particles resembles ApoE enrichment of lipoproteins as a ligand for the LDL receptor-related protein. Biochemistry. 2006 Jan 17;45 (2) :381-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CDK2 Antibody (AN4.3)
NB100-2721-0.025mg 0.025 mg

Mouse Monoclonal CDK2 Antibody (AN4.3)

Sign In for Pricing
View Details
SHFL Rabbit Polyclonal Antibody
TA330679 100 µL

SHFL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FH Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV666090 1.0 µg DNA

FH Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Shigella Boydii bioB Protein (aa 1-346) (strain CDC 3083-94 / BS512)
VAng-Lsx08557-50gEcoli 50 µg (E. coli)

Recombinant Shigella Boydii bioB Protein (aa 1-346) (strain CDC 3083-94 / BS512)

Sign In for Pricing
View Details
Mouse Dnajc19 (NM_001286972) AAV Particle
MR228011A1V 250 µL

Mouse Dnajc19 (NM_001286972) AAV Particle

Sign In for Pricing
View Details
Mh Ii Agar 500gm
211438 1 Each

Mh Ii Agar 500gm

Sign In for Pricing
View Details