Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein M/APOM, Human (HEK293, His)

Apolipoprotein M Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1]. The signal peptide is not cleaved and is required for ApoM association with lipoprotein particles as well as Megalin mediated reabsorption by the kidney. ApoM is cleared from the circulation by the ubiquitously expressed LDL R.

Product Specifications

Product Name Alternative

Apolipoprotein M/APOM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-m-protein-human-hek293-his.html

Purity

98.0

Smiles

CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Molecular Formula

55937 (Gene_ID) O95445-1 (M1-N188) (Accession)

Molecular Weight

19-24 kDa

References & Citations

[1]LaDu MJ, et al. Self-assembly of HEK cell-secreted ApoE particles resembles ApoE enrichment of lipoproteins as a ligand for the LDL receptor-related protein. Biochemistry. 2006 Jan 17;45 (2) :381-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxsr1 Antibody
GWB-MR225I 50 µg

Oxsr1 Antibody

Sign In for Pricing
View Details
PLV3-CMV-Lrp10 (mouse) -3xFLAG-CopGFP-Puro
BZ54468 1 Vial

PLV3-CMV-Lrp10 (mouse) -3xFLAG-CopGFP-Puro

Sign In for Pricing
View Details
POPD3, CT (POPDC3, POP3, Popeye domain-containing protein 3) (FITC)
MBS6335909-01 0.2 mL

POPD3, CT (POPDC3, POP3, Popeye domain-containing protein 3) (FITC)

Sign In for Pricing
View Details
POPD3, CT (POPDC3, POP3, Popeye domain-containing protein 3) (FITC)
MBS6335909-02 5x 0.2 mL

POPD3, CT (POPDC3, POP3, Popeye domain-containing protein 3) (FITC)

Sign In for Pricing
View Details
Zfp930 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
51178124 3x 1.0µg DNA

Zfp930 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Rack (HxD) 2x4=8 boxes, 130mm, 268x562x140mm, Sliding shelf
TE25202 1 Piece

Rack (HxD) 2x4=8 boxes, 130mm, 268x562x140mm, Sliding shelf

Sign In for Pricing
View Details