Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein M/APOM, Human (HEK293, His)

Apolipoprotein M Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1]. The signal peptide is not cleaved and is required for ApoM association with lipoprotein particles as well as Megalin mediated reabsorption by the kidney. ApoM is cleared from the circulation by the ubiquitously expressed LDL R.

Product Specifications

Product Name Alternative

Apolipoprotein M/APOM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-m-protein-human-hek293-his.html

Purity

98.0

Smiles

CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Molecular Formula

55937 (Gene_ID) O95445-1 (M1-N188) (Accession)

Molecular Weight

19-24 kDa

References & Citations

[1]LaDu MJ, et al. Self-assembly of HEK cell-secreted ApoE particles resembles ApoE enrichment of lipoproteins as a ligand for the LDL receptor-related protein. Biochemistry. 2006 Jan 17;45 (2) :381-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KMS-12-PE
ABL-TC0347 1 Vial

KMS-12-PE

Sign In for Pricing
View Details
RING Finger Protein 139 (RNF139, E3 Ubiquitin-protein Ligase RNF139, HRCA1, RCA1, Translocation in Renal Carcinoma on Chromosome 8 Protein, TRC8) (Biotin)
132654-Biotin 100 µL

RING Finger Protein 139 (RNF139, E3 Ubiquitin-protein Ligase RNF139, HRCA1, RCA1, Translocation in Renal Carcinoma on Chromosome 8 Protein, TRC8) (Biotin)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12/DH10B) LLDD Polyclonal Antibody
MBS7184769 Inquire

Rabbit anti-Escherichia coli (strain K12/DH10B) LLDD Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Meprin alpha Subunit/MEP1A Antibody (364312) [Allophycocyanin]
FAB3220A 0.1 mL

Mouse Monoclonal Meprin alpha Subunit/MEP1A Antibody (364312) [Allophycocyanin]

Sign In for Pricing
View Details
CS025 Rabbit Polyclonal Antibody
JOT-AP08483-01 50ul

CS025 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CS025 Rabbit Polyclonal Antibody
JOT-AP08483-02 100ul

CS025 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details