Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein M/APOM, Human (HEK293, His)

Apolipoprotein M Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1]. The signal peptide is not cleaved and is required for ApoM association with lipoprotein particles as well as Megalin mediated reabsorption by the kidney. ApoM is cleared from the circulation by the ubiquitously expressed LDL R.

Product Specifications

Product Name Alternative

Apolipoprotein M/APOM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-m-protein-human-hek293-his.html

Purity

98.0

Smiles

CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Molecular Formula

55937 (Gene_ID) O95445-1 (M1-N188) (Accession)

Molecular Weight

19-24 kDa

References & Citations

[1]LaDu MJ, et al. Self-assembly of HEK cell-secreted ApoE particles resembles ApoE enrichment of lipoproteins as a ligand for the LDL receptor-related protein. Biochemistry. 2006 Jan 17;45 (2) :381-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AIM2 (Absent In Melanoma 2) ELISA Kit
ELK4291-01 48 Tests

Human AIM2 (Absent In Melanoma 2) ELISA Kit

Sign In for Pricing
View Details
Human AIM2 (Absent In Melanoma 2) ELISA Kit
ELK4291-02 96 Tests

Human AIM2 (Absent In Melanoma 2) ELISA Kit

Sign In for Pricing
View Details
Human AIM2 (Absent In Melanoma 2) ELISA Kit
ELK4291-03 5x 96 Tests

Human AIM2 (Absent In Melanoma 2) ELISA Kit

Sign In for Pricing
View Details
Human Myosin regulatory light chain 10, MYL10 ELISA KIT
ELI-37456h 96 Tests

Human Myosin regulatory light chain 10, MYL10 ELISA KIT

Sign In for Pricing
View Details
Cdo1 (NM_052809) Rat Tagged Lenti ORF Clone
RR207615L4 10 µg

Cdo1 (NM_052809) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RBBP4 Protein (N-His, Mouse)
P528007 100 µg

RBBP4 Protein (N-His, Mouse)

Sign In for Pricing
View Details