Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein M/APOM, Human (HEK293, His)

Apolipoprotein M Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1]. The signal peptide is not cleaved and is required for ApoM association with lipoprotein particles as well as Megalin mediated reabsorption by the kidney. ApoM is cleared from the circulation by the ubiquitously expressed LDL R.

Product Specifications

Product Name Alternative

Apolipoprotein M/APOM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-m-protein-human-hek293-his.html

Purity

98.0

Smiles

CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Molecular Formula

55937 (Gene_ID) O95445-1 (M1-N188) (Accession)

Molecular Weight

19-24 kDa

References & Citations

[1]LaDu MJ, et al. Self-assembly of HEK cell-secreted ApoE particles resembles ApoE enrichment of lipoproteins as a ligand for the LDL receptor-related protein. Biochemistry. 2006 Jan 17;45 (2) :381-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

B4GALNT1 (Beta-1, 4-N-Acetyl-Galactosaminyl Transferase 1, GALGT, GALNACT) (HRP)
123782-HRP 100 µL

B4GALNT1 (Beta-1, 4-N-Acetyl-Galactosaminyl Transferase 1, GALGT, GALNACT) (HRP)

Sign In for Pricing
View Details
anti-RBCK1
YF-PA17100 100 ug

anti-RBCK1

Sign In for Pricing
View Details
CD4 Rabbit Monoclonal Antibody
AG1397 50 µL

CD4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
C14orf45 (BBOF1) CytoSection
TS407270P5 25 Slides

C14orf45 (BBOF1) CytoSection

Sign In for Pricing
View Details
CAMK2A (NM_015981) Human Tagged Lenti ORF Clone
RC218186L3 10 µg

CAMK2A (NM_015981) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TAF1D Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV652586 1.0 µg DNA

TAF1D Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details