Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein M/APOM, Human (HEK293, His)

Apolipoprotein M Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1]. The signal peptide is not cleaved and is required for ApoM association with lipoprotein particles as well as Megalin mediated reabsorption by the kidney. ApoM is cleared from the circulation by the ubiquitously expressed LDL R.

Product Specifications

Product Name Alternative

Apolipoprotein M/APOM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-m-protein-human-hek293-his.html

Purity

98.0

Smiles

CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Molecular Formula

55937 (Gene_ID) O95445-1 (M1-N188) (Accession)

Molecular Weight

19-24 kDa

References & Citations

[1]LaDu MJ, et al. Self-assembly of HEK cell-secreted ApoE particles resembles ApoE enrichment of lipoproteins as a ligand for the LDL receptor-related protein. Biochemistry. 2006 Jan 17;45 (2) :381-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dmd ORF Vector (Rat) (pORF)
ORF066072 1.0 µg DNA

Dmd ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Bacteria-Derived GFAP Recombinant Protein N-6His Tag Lyophilized
MBS8430570-01 0.01 mg

Bacteria-Derived GFAP Recombinant Protein N-6His Tag Lyophilized

Sign In for Pricing
View Details
Bacteria-Derived GFAP Recombinant Protein N-6His Tag Lyophilized
MBS8430570-02 5x 0.01 mg

Bacteria-Derived GFAP Recombinant Protein N-6His Tag Lyophilized

Sign In for Pricing
View Details
G CSF (CSF3) (NM_000759) Human Over-expression Lysate
LS001440-20ug 20 µg

G CSF (CSF3) (NM_000759) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Anti-Rat Cardiotrophin Like Cytokine Factor 1 (CLCF1) Polyclonal Antibody
VD3N854 1 Each

Rabbit Anti-Rat Cardiotrophin Like Cytokine Factor 1 (CLCF1) Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human ZNF324B sgRNA gene knockout kit - Lentiviral human ZNF324B sgRNA gene knockout kit (100)
GTR15390907 1 Vial

Lentiviral human ZNF324B sgRNA gene knockout kit - Lentiviral human ZNF324B sgRNA gene knockout kit (100)

Sign In for Pricing
View Details