Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein M/APOM, Human (HEK293, His)

Apolipoprotein M Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1]. The signal peptide is not cleaved and is required for ApoM association with lipoprotein particles as well as Megalin mediated reabsorption by the kidney. ApoM is cleared from the circulation by the ubiquitously expressed LDL R.

Product Specifications

Product Name Alternative

Apolipoprotein M/APOM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-m-protein-human-hek293-his.html

Purity

98.0

Smiles

CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Molecular Formula

55937 (Gene_ID) O95445-1 (M1-N188) (Accession)

Molecular Weight

19-24 kDa

References & Citations

[1]LaDu MJ, et al. Self-assembly of HEK cell-secreted ApoE particles resembles ApoE enrichment of lipoproteins as a ligand for the LDL receptor-related protein. Biochemistry. 2006 Jan 17;45 (2) :381-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL5P29 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV774926 1.0 µg DNA

RPL5P29 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
PCGF6 Antibody / Polycomb group RING finger protein 6
FY12771 100 µg

PCGF6 Antibody / Polycomb group RING finger protein 6

Sign In for Pricing
View Details
DDA1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV620879 1.0 µg DNA

DDA1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
CEP41 Antibody
A42976-100UG 100 µg

CEP41 Antibody

Sign In for Pricing
View Details
HEPBS
GK1938-100g 100 g

HEPBS

Sign In for Pricing
View Details
SULT1A1 Mouse Monoclonal Antibody [Clone ID: LBI5F1]
AMM10382V 100 µL

SULT1A1 Mouse Monoclonal Antibody [Clone ID: LBI5F1]

Sign In for Pricing
View Details