Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein M/APOM, Human (HEK293, His)

Apolipoprotein M Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1]. The signal peptide is not cleaved and is required for ApoM association with lipoprotein particles as well as Megalin mediated reabsorption by the kidney. ApoM is cleared from the circulation by the ubiquitously expressed LDL R.

Product Specifications

Product Name Alternative

Apolipoprotein M/APOM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-m-protein-human-hek293-his.html

Purity

98.0

Smiles

CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Molecular Formula

55937 (Gene_ID) O95445-1 (M1-N188) (Accession)

Molecular Weight

19-24 kDa

References & Citations

[1]LaDu MJ, et al. Self-assembly of HEK cell-secreted ApoE particles resembles ApoE enrichment of lipoproteins as a ligand for the LDL receptor-related protein. Biochemistry. 2006 Jan 17;45 (2) :381-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Golgin A8 Family, Member A (GOLGA8A) ELISA Kit
RDR-GOLGA8A-Hu-48Tests 48 Tests

Human Golgin A8 Family, Member A (GOLGA8A) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
MBS1233652-01 0.02 mg (E-Coli)

Recombinant Mycobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
MBS1233652-02 0.02 mg (Yeast)

Recombinant Mycobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
MBS1233652-03 0.1 mg (E-Coli)

Recombinant Mycobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
MBS1233652-04 0.1 mg (Yeast)

Recombinant Mycobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
MBS1233652-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium sp. 3-phosphoshikimate 1-carboxyvinyltransferase (aroA)

Sign In for Pricing
View Details