Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein M/APOM, Human (HEK293, His)

Apolipoprotein M Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1]. The signal peptide is not cleaved and is required for ApoM association with lipoprotein particles as well as Megalin mediated reabsorption by the kidney. ApoM is cleared from the circulation by the ubiquitously expressed LDL R.

Product Specifications

Product Name Alternative

Apolipoprotein M/APOM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-m-protein-human-hek293-his.html

Purity

98.0

Smiles

CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Molecular Formula

55937 (Gene_ID) O95445-1 (M1-N188) (Accession)

Molecular Weight

19-24 kDa

References & Citations

[1]LaDu MJ, et al. Self-assembly of HEK cell-secreted ApoE particles resembles ApoE enrichment of lipoproteins as a ligand for the LDL receptor-related protein. Biochemistry. 2006 Jan 17;45 (2) :381-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1310, ID (KANSL3, KIAA1310, NSL3, PRTD, SI1, KAT8 regulatory NSL complex subunit 3, NSL complex protein NSL3, Non-specific lethal 3 homolog, Serum inhibited-related protein, Testis development protein PRTD) (MaxLight 405)
MBS6313110-01 0.1 mL

KIAA1310, ID (KANSL3, KIAA1310, NSL3, PRTD, SI1, KAT8 regulatory NSL complex subunit 3, NSL complex protein NSL3, Non-specific lethal 3 homolog, Serum inhibited-related protein, Testis development protein PRTD) (MaxLight 405)

Sign In for Pricing
View Details
KIAA1310, ID (KANSL3, KIAA1310, NSL3, PRTD, SI1, KAT8 regulatory NSL complex subunit 3, NSL complex protein NSL3, Non-specific lethal 3 homolog, Serum inhibited-related protein, Testis development protein PRTD) (MaxLight 405)
MBS6313110-02 5x 0.1 mL

KIAA1310, ID (KANSL3, KIAA1310, NSL3, PRTD, SI1, KAT8 regulatory NSL complex subunit 3, NSL complex protein NSL3, Non-specific lethal 3 homolog, Serum inhibited-related protein, Testis development protein PRTD) (MaxLight 405)

Sign In for Pricing
View Details
4- (3- (Dimethylamino) propylcarbamoyl) phenylboronic acid, pinacol ester
428745-01 100 mg

4- (3- (Dimethylamino) propylcarbamoyl) phenylboronic acid, pinacol ester

Sign In for Pricing
View Details
4- (3- (Dimethylamino) propylcarbamoyl) phenylboronic acid, pinacol ester
428745-02 250 mg

4- (3- (Dimethylamino) propylcarbamoyl) phenylboronic acid, pinacol ester

Sign In for Pricing
View Details
Lentiviral human POLE shRNA (UAS) - Lentiviral human POLE shRNA (UAS) plasmid
GTR15109231 1 Vial

Lentiviral human POLE shRNA (UAS) - Lentiviral human POLE shRNA (UAS) plasmid

Sign In for Pricing
View Details
ZNF879 (Zinc Finger Protein 879)
496917 100 µL

ZNF879 (Zinc Finger Protein 879)

Sign In for Pricing
View Details