Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein M/APOM, Human (HEK293, His)

Apolipoprotein M Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1]. The signal peptide is not cleaved and is required for ApoM association with lipoprotein particles as well as Megalin mediated reabsorption by the kidney. ApoM is cleared from the circulation by the ubiquitously expressed LDL R.

Product Specifications

Product Name Alternative

Apolipoprotein M/APOM Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-m-protein-human-hek293-his.html

Purity

98.0

Smiles

CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Molecular Formula

55937 (Gene_ID) O95445-1 (M1-N188) (Accession)

Molecular Weight

19-24 kDa

References & Citations

[1]LaDu MJ, et al. Self-assembly of HEK cell-secreted ApoE particles resembles ApoE enrichment of lipoproteins as a ligand for the LDL receptor-related protein. Biochemistry. 2006 Jan 17;45 (2) :381-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Kinase D2 (PRKD2) (C-term) rabbit polyclonal antibody, Purified
AP31327PU-N 50 µL

Protein Kinase D2 (PRKD2) (C-term) rabbit polyclonal antibody, Purified

Sign In for Pricing
View Details
Recombinant Coxiella burnetii NADH-quinone oxidoreductase subunit K (nuoK), partial
MBS7091568 Inquire

Recombinant Coxiella burnetii NADH-quinone oxidoreductase subunit K (nuoK), partial

Sign In for Pricing
View Details
EGR3 (NM_004430) Human Tagged ORF Clone Lentiviral Particle
RC211140L2V 200 µL

EGR3 (NM_004430) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
10-Hydroxydecanoic Acid
411643-01 1 g

10-Hydroxydecanoic Acid

Sign In for Pricing
View Details
10-Hydroxydecanoic Acid
411643-02 5 g

10-Hydroxydecanoic Acid

Sign In for Pricing
View Details
HADH Rabbit pAb (APR18261N)
APR18261N-01 50 µL

HADH Rabbit pAb (APR18261N)

Sign In for Pricing
View Details