Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40)

Product Specifications

Product Name Alternative

Ebola VP40 (eVP40) (Membrane-associated protein VP40)

Abbreviation

Recombinant Zaire ebolavirus VP40 protein

Gene Name

VP40

UniProt

Q77DJ6

Expression Region

1-326aa

Organism

Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)

Target Sequence

MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Others

Relevance

Plays an essential role virus particle assembly and budding. Acts by interacting with viral ribonucleocapsid and host members of the ESCRT system such as host VPS4, PDCD6IP/ALIX, NEDD4 or TGS101. May play a role in immune cell dysfunction by being packaged into exosomes that can decrease the viability of recipient cells.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.1 kDa

References & Citations

"Crystal structure of the matrix protein VP40 from Ebola virus." Dessen A., Volchkov V., Dolnik O., Klenk H.-D., Weissenhorn W. EMBO J. 19:4228-4236 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rana dybowskii Cytochrome b (mt-cyb), partial
MBS7099504 Inquire

Recombinant Rana dybowskii Cytochrome b (mt-cyb), partial

Sign In for Pricing
View Details
Anti-GLUT2/SLC2A2 (Rabbit, Polyclonal)
A113687 100 µL

Anti-GLUT2/SLC2A2 (Rabbit, Polyclonal)

Sign In for Pricing
View Details
Ccndbp1 (NM_001013204) Rat Untagged Clone
RN206788 10 µg

Ccndbp1 (NM_001013204) Rat Untagged Clone

Sign In for Pricing
View Details
Cadherin-1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-42419R-BF405 100 µL

Cadherin-1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
GPR148 Antibody
MBS9604240-01 0.1 mL

GPR148 Antibody

Sign In for Pricing
View Details
GPR148 Antibody
MBS9604240-02 0.2 mL

GPR148 Antibody

Sign In for Pricing
View Details