Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 S glycoprotein (HEK293, His, Flag)

The SARS-CoV-2 S glycoprotein is critical in infection, binding to the ACE2 receptor and allowing viral particles to attach to the host cell membrane. Cleavage of S2/S2′ triggers cell membrane fusion or internalization via endocytosis. SARS-CoV-2 S glycoprotein (HEK293, His, Flag) is the recombinant Virus-derived SARS-CoV-2 S glycoprotein, expressed by HEK293 , with N-10*His, C-Flag labeled tag.

Product Specifications

Product Name Alternative

SARS-CoV-2 S glycoprotein (HEK293, His, Flag), Virus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sars-cov-2-s-glycoprotein-hek-293-his-flag.html

Purity

90.0

Smiles

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

Molecular Formula

43740568 (Gene_ID) P0DTC2 (V16-R685) (Accession)

Molecular Weight

Approximately 120 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amd1 Mouse shRNA Plasmid (Locus ID 11702)
TL500086 1 Kit

Amd1 Mouse shRNA Plasmid (Locus ID 11702)

Sign In for Pricing
View Details
N-[2- (4-Hydroxyphenyl) ethyl]acetamide-d4
165223 1 mg

N-[2- (4-Hydroxyphenyl) ethyl]acetamide-d4

Sign In for Pricing
View Details
Stirrer Bar Micro Yellow 15x1 5mm
STI4058 1 Each

Stirrer Bar Micro Yellow 15x1 5mm

Sign In for Pricing
View Details
Mouse Mynn qPCR Primer Pair
QM46682S 200 Tests

Mouse Mynn qPCR Primer Pair

Sign In for Pricing
View Details
KIN CRISPRa sgRNA lentivector (set of three targets)(Rat)
25702126 3x 1.0µg DNA

KIN CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Def6 (NM_027185) Mouse Recombinant Protein
PM44181M5 20 µg

Def6 (NM_027185) Mouse Recombinant Protein

Sign In for Pricing
View Details