Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Mouse (HEK293)

IL-3 protein is secreted by T lymphocytes, mast cells and osteoblasts. It plays an important regulatory role in hematopoietic progenitor cells and stimulates mature basophils, eosinophils and monocytes. In addition to hematopoiesis, it supports neuronal cell proliferation, survival, and bone homeostasis by inhibiting osteoclast differentiation. IL-3 Protein, Mouse (HEK293) is the recombinant mouse-derived IL-3 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IL-3 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-mouse-hek293.html

Purity

98.0

Smiles

MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Formula

16187 (Gene_ID) P01586 (A27-C166) /NP_034686.2 (Accession)

Molecular Weight

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DHX33 (NM_020162) Human Over-expression Lysate
LH11063V 100 µg

DHX33 (NM_020162) Human Over-expression Lysate

Ask
View Details
TPA (Tissue-type Plasminogen Activator, t-plasminogen Activator, t-PA, tPA, Alteplase, INN=Reteplase, Tissue-type Plasminogen Activator Chain A, Tissue-type Plasminogen Activator Chain B, PLAT) (FITC)
134629-FITC 100 µL

TPA (Tissue-type Plasminogen Activator, t-plasminogen Activator, t-PA, tPA, Alteplase, INN=Reteplase, Tissue-type Plasminogen Activator Chain A, Tissue-type Plasminogen Activator Chain B, PLAT) (FITC)

Ask
View Details
CD61 (Glycoprotein IIIa, Integrin beta3) (MaxLight 550)
C2414-10B-ML550 100 µL

CD61 (Glycoprotein IIIa, Integrin beta3) (MaxLight 550)

Ask
View Details
DLX5 Human Pre-designed siRNA Set A
HY-RS03816 1 Set

DLX5 Human Pre-designed siRNA Set A

Ask
View Details