Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Mouse (HEK293)

IL-3 protein is secreted by T lymphocytes, mast cells and osteoblasts. It plays an important regulatory role in hematopoietic progenitor cells and stimulates mature basophils, eosinophils and monocytes. In addition to hematopoiesis, it supports neuronal cell proliferation, survival, and bone homeostasis by inhibiting osteoclast differentiation. IL-3 Protein, Mouse (HEK293) is the recombinant mouse-derived IL-3 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IL-3 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-mouse-hek293.html

Purity

98.0

Smiles

MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Formula

16187 (Gene_ID) P01586 (A27-C166) /NP_034686.2 (Accession)

Molecular Weight

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protein SCO1 homolog, mitochondrial, SCO1 ELISA KIT
ELI-41589h 96 Tests

Human Protein SCO1 homolog, mitochondrial, SCO1 ELISA KIT

Sign In for Pricing
View Details
YgeK Antibody
orb831520 2 mg

YgeK Antibody

Sign In for Pricing
View Details
Annexin III (ANX III) Human ELISA Kit
B5291 96 Tests

Annexin III (ANX III) Human ELISA Kit

Sign In for Pricing
View Details
CASP3 Knockout NCI-H1299 Polyclonal Cells
ARG42446 1 Million

CASP3 Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
Zomepirac-acyl-b-D-glucuronide
295109-01 1 mg

Zomepirac-acyl-b-D-glucuronide

Sign In for Pricing
View Details
Zomepirac-acyl-b-D-glucuronide
295109-02 2 mg

Zomepirac-acyl-b-D-glucuronide

Sign In for Pricing
View Details