Epigen, Human
Epigen Protein, Human is a EGF-like growth factor that does not stimulate cells singly expressing ErbB-2, but acts as a mitogen for cells expressing ErbB-1 and co-expressing ErbB-2 in combination with the other ErbBs, with potent mitogenic activity.
Product Specifications
Product Name Alternative
Epigen Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/epigen-protein-human.html
Purity
95.00
Smiles
AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA
Molecular Formula
255324 (Gene_ID) Q6UW88-2 (A24-A95) (Accession)
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Kochupurakkal BS, et al. Epigen, the last ligand of ErbB receptors, reveals intricate relationships between affinity and mitogenicity. J Biol Chem. 2005 Mar 4;280 (9) :8503-12.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-62840R-RBITC 100 µL
Phospho-STK4/3 (Thr183/Thr180) Recombinant Antibody, RBITC Conjugated
Sign In for Pricing
View Details 
A11609-3-Fluoro647 100 µg/Vial
Anti-SSH3 Antibody Picoband® Fluoro647 Conjugated
Sign In for Pricing
View Details 
357279-01 48 Tests
MEP1B (Meprin A subunit beta) BioAssayTM ELISA Kit (Human) discontinued
Sign In for Pricing
View Details 357279-02 96 Tests
MEP1B (Meprin A subunit beta) BioAssayTM ELISA Kit (Human) discontinued
Sign In for Pricing
View Details