Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse XIAP-associated factor 1 (Xaf1)

Product Specifications

Product Name Alternative

BIRC4-binding protein

Abbreviation

Recombinant Mouse Xaf1 protein

Gene Name

Xaf1

UniProt

Q5NBU8

Expression Region

1-273aa

Organism

Mus musculus (Mouse)

Target Sequence

MEADFQVCRNCKRNVASLHFMLHEAHCLRFIVLCPECEEPIPESKMKEHMEVVHQQTKESQQHPAKCKFCELAVQLSNLDVHESHCGSRTEHCPHCNQPITLQVLSQHKAMCLSAKGRPEEGKRIVSSPGRKTRCDLCKQMIPENTYASHMKQCSAPNTVTRIRDESIIVIPSTLAFMDSGNRRSTVSKDVRPKTKNRNSSTKRETKKQNGTVALPLKSGLQQRADLPTGDETAYDTLQNCCQCRILLPLPILNEHQEKCQRLAHQKKLQWGW

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Seems to function as a negative regulator of members of the IAP (inhibitor of apoptosis protein) family. Inhibits anti-caspase activity of BIRC4. Induces cleavage and inactivation of BIRC4 independent of caspase activation. Mediates TNF-alpha-induced apoptosis and is involved in apoptosis in trophoblast cells. May inhibit BIRC4 indirectly by activating the mitochondrial apoptosis pathway. After translocation to mitochondria, promotes translocation of BAX to mitochondria and cytochrome c release from mitochondria. Seems to promote the redistribution of BIRC4 from the cytoplasm to the nucleus, probably independent of BIRC4 inactivation which seems to occur in the cytoplasm. The BIRC4-XAF1 complex mediates down-regulation of BIRC5/survivin; the process requires the E3 ligase activity of BIRC4. Seems to be involved in cellular sensitivity to the proapoptotic actions of TRAIL. May be a tumor suppressor by mediating apoptosis resistance of cancer cells.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ABCG4 Antibody
NBP3-17072-100ul 100 µL

Rabbit Polyclonal ABCG4 Antibody

Sign In for Pricing
View Details
Anti-CD37 Antibody-FITC labled
MBS8203850-01 50 Assays

Anti-CD37 Antibody-FITC labled

Sign In for Pricing
View Details
Anti-CD37 Antibody-FITC labled
MBS8203850-02 100 Assays

Anti-CD37 Antibody-FITC labled

Sign In for Pricing
View Details
Anti-CD37 Antibody-FITC labled
MBS8203850-03 5x 100 Assays

Anti-CD37 Antibody-FITC labled

Sign In for Pricing
View Details
UBE2D2 Antibody
orb1316449 100 µL

UBE2D2 Antibody

Sign In for Pricing
View Details
Na+ CP type IIβ HDR Plasmid (h)
sc-407406-HDR 20 µg

Na+ CP type IIβ HDR Plasmid (h)

Sign In for Pricing
View Details