Recombinant Mouse XIAP-associated factor 1 (Xaf1)
Product Specifications
Product Name Alternative
BIRC4-binding protein
Abbreviation
Recombinant Mouse Xaf1 protein
Gene Name
Xaf1
UniProt
Q5NBU8
Expression Region
1-273aa
Organism
Mus musculus (Mouse)
Target Sequence
MEADFQVCRNCKRNVASLHFMLHEAHCLRFIVLCPECEEPIPESKMKEHMEVVHQQTKESQQHPAKCKFCELAVQLSNLDVHESHCGSRTEHCPHCNQPITLQVLSQHKAMCLSAKGRPEEGKRIVSSPGRKTRCDLCKQMIPENTYASHMKQCSAPNTVTRIRDESIIVIPSTLAFMDSGNRRSTVSKDVRPKTKNRNSSTKRETKKQNGTVALPLKSGLQQRADLPTGDETAYDTLQNCCQCRILLPLPILNEHQEKCQRLAHQKKLQWGW
Tag
C-terminal 6xHis-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Cell Biology
Relevance
Seems to function as a negative regulator of members of the IAP (inhibitor of apoptosis protein) family. Inhibits anti-caspase activity of BIRC4. Induces cleavage and inactivation of BIRC4 independent of caspase activation. Mediates TNF-alpha-induced apoptosis and is involved in apoptosis in trophoblast cells. May inhibit BIRC4 indirectly by activating the mitochondrial apoptosis pathway. After translocation to mitochondria, promotes translocation of BAX to mitochondria and cytochrome c release from mitochondria. Seems to promote the redistribution of BIRC4 from the cytoplasm to the nucleus, probably independent of BIRC4 inactivation which seems to occur in the cytoplasm. The BIRC4-XAF1 complex mediates down-regulation of BIRC5/survivin; the process requires the E3 ligase activity of BIRC4. Seems to be involved in cellular sensitivity to the proapoptotic actions of TRAIL. May be a tumor suppressor by mediating apoptosis resistance of cancer cells.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
38.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items