Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Heat-labile enterotoxin B chain (eltB)

Product Specifications

Product Name Alternative

(LT-B, porcine) (LTP-B)

Abbreviation

Recombinant E.coli eltB protein

Gene Name

EltB

UniProt

P32890

Expression Region

22-124aa

Organism

Escherichia coli

Target Sequence

APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.2 kDa

References & Citations

"Structure of m-carboxyphenyl-alpha-D-galactopyranoside complexed to heat-labile enterotoxin at 1.3 A resolution: surprising variations in ligand-binding modes." Minke W.E., Pickens J., Merritt E.A., Fan E., Verlinde C.L., Hol W.G. Acta Crystallogr D Biol Crystallogr 56:795-804 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human thioredoxin reductase (TrxR) ELISA Kit
YP-W11050-01 48 Tests

Human thioredoxin reductase (TrxR) ELISA Kit

Sign In for Pricing
View Details
Human thioredoxin reductase (TrxR) ELISA Kit
YP-W11050-02 96 Tests

Human thioredoxin reductase (TrxR) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Citrate synthase antibody
SLM-54190R-01 50 µL

Rabbit Anti-Citrate synthase antibody

Sign In for Pricing
View Details
Rabbit Anti-Citrate synthase antibody
SLM-54190R-02 100 µL

Rabbit Anti-Citrate synthase antibody

Sign In for Pricing
View Details
DAB2 (DOC-2, Differentially-expressed Protein 2, Disabled Homolog 2, DOC2) (MaxLight 550)
MBS6211065-01 0.1 mL

DAB2 (DOC-2, Differentially-expressed Protein 2, Disabled Homolog 2, DOC2) (MaxLight 550)

Sign In for Pricing
View Details
DAB2 (DOC-2, Differentially-expressed Protein 2, Disabled Homolog 2, DOC2) (MaxLight 550)
MBS6211065-02 5x 0.1 mL

DAB2 (DOC-2, Differentially-expressed Protein 2, Disabled Homolog 2, DOC2) (MaxLight 550)

Sign In for Pricing
View Details