Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXTL2, Mouse (HEK293, His)

The EXTL2 protein is a key glycosyltransferase in heparan sulfate biosynthesis, responsible for overseeing the conversion of β-1-4-linked glucuronic acid (GlcA) and α-1-4-linked N-acetylglucosamine (GlcNAc) units Alternating sulfate chains are added to the nascent heparan. The function of this enzyme is critical for the complex and precise construction of heparan sulfate, a key component of various biological processes. EXTL2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EXTL2 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EXTL2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/extl2-protein-mouse-hek-293-his.html

Smiles

NIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM

Molecular Formula

58193 (Gene_ID) Q9ES89 (N43-M330) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Os03g0144800 Antibody
orb840783 2 mg

Os03g0144800 Antibody

Sign In for Pricing
View Details
TBX1 Protein Vector (Mouse) (pPB-N-His)
PV236859 500 ng

TBX1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Lymph node of cat, t.s. routine stained
Ma2323c 7.6 x 2.6 cm

Lymph node of cat, t.s. routine stained

Sign In for Pricing
View Details
Mouse Cib2 ELISA Kit
EF014498 96 Tests

Mouse Cib2 ELISA Kit

Sign In for Pricing
View Details
Goat Zinc finger protein Gfi 1b (GFI1B) ELISA kit
GTR10414066 96 Well

Goat Zinc finger protein Gfi 1b (GFI1B) ELISA kit

Sign In for Pricing
View Details
NeuN Rabbit pAb, BF700 conjugated
orb2826837 100 µL

NeuN Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details