Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-1 alpha/CCL3, Rat

The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MIP-1 alpha/CCL3 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl3-protein-rat.html

Purity

95.0

Smiles

APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

Molecular Formula

25542 (Gene_ID) P50229 (A24-A92) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Centromere protein X (STRA13) ELISA Kit
MBS7208754-01 48 Well

Mouse Centromere protein X (STRA13) ELISA Kit

Ask
View Details
Mouse Centromere protein X (STRA13) ELISA Kit
MBS7208754-02 96 Well

Mouse Centromere protein X (STRA13) ELISA Kit

Ask
View Details
Mouse Centromere protein X (STRA13) ELISA Kit
MBS7208754-03 5x 96 Well

Mouse Centromere protein X (STRA13) ELISA Kit

Ask
View Details
Mouse Centromere protein X (STRA13) ELISA Kit
MBS7208754-04 10x 96 Well

Mouse Centromere protein X (STRA13) ELISA Kit

Ask
View Details
Anti-BIRC7 antibody
STJ114474 100 µl

Anti-BIRC7 antibody

Ask
View Details
AF9, CT (K486) (MLLT3, AF9, YEATS3, Protein AF-9, ALL1-fused gene from chromosome 9 protein, Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein, YEATS domain-containing protein 3) (MaxLight 550) discontinued
031674-ML550 100 µL

AF9, CT (K486) (MLLT3, AF9, YEATS3, Protein AF-9, ALL1-fused gene from chromosome 9 protein, Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein, YEATS domain-containing protein 3) (MaxLight 550) discontinued

Ask
View Details