Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-1 alpha/CCL3, Rat

The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MIP-1 alpha/CCL3 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl3-protein-rat.html

Purity

95.0

Smiles

APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

Molecular Formula

25542 (Gene_ID) P50229 (A24-A92) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-amino-3- (carboxymethylsulfinyl) propanoic acid
JH334352 1 Each

2-amino-3- (carboxymethylsulfinyl) propanoic acid

Sign In for Pricing
View Details
IGHV4-30-2 3'UTR GFP Stable Cell Line
TU060706 1.0 mL

IGHV4-30-2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal UBQLN4/CIP75 Antibody [PerCP]
NBP2-98562PCP 0.1 mL

Rabbit Polyclonal UBQLN4/CIP75 Antibody [PerCP]

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 Macrodomain Ter protein (matP)
MBS1005843-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O127:H6 Macrodomain Ter protein (matP)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 Macrodomain Ter protein (matP)
MBS1005843-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O127:H6 Macrodomain Ter protein (matP)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 Macrodomain Ter protein (matP)
MBS1005843-03 0.02 mg (Yeast)

Recombinant Escherichia coli O127:H6 Macrodomain Ter protein (matP)

Sign In for Pricing
View Details