Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-1 alpha/CCL3, Rat

The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MIP-1 alpha/CCL3 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl3-protein-rat.html

Purity

95.0

Smiles

APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

Molecular Formula

25542 (Gene_ID) P50229 (A24-A92) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Asmtl Pre-designed siRNA Set A
SI201039A 1 Each

Rat Asmtl Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse SBF1 siRNA
abx932501-01 15 nmol

Mouse SBF1 siRNA

Sign In for Pricing
View Details
Mouse SBF1 siRNA
abx932501-02 30 nmol

Mouse SBF1 siRNA

Sign In for Pricing
View Details
RRP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
42753062 1.0 µg DNA

RRP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Pion sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6601208 1.0 µg DNA

Pion sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Sialyllacto-N-Tetraose C (LST-c)
S5120-01 1 mg

Sialyllacto-N-Tetraose C (LST-c)

Sign In for Pricing
View Details