MIP-1 alpha/CCL3, Rat
The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
MIP-1 alpha/CCL3 Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ccl3-protein-rat.html
Purity
95.0
Smiles
APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA
Molecular Formula
25542 (Gene_ID) P50229 (A24-A92) (Accession)
Molecular Weight
Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Mouse Polyclonal Pregnancy specific beta 1 glycoprotein 11 Antibody
RPL29P31 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
Mouse C-Reactive Recombinant Protein/CRP Recombinant Protein
Polyclonal Antibody to Heat Shock Protein 90 (HSP90)
