Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-1 alpha/CCL3, Rat

The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MIP-1 alpha/CCL3 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl3-protein-rat.html

Purity

95.0

Smiles

APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

Molecular Formula

25542 (Gene_ID) P50229 (A24-A92) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fbxl15 Pre-designed siRNA Set B
SI104769B 1 Each

Mouse Fbxl15 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Transglutaminase 5 (TGM5) CytoSection
TS415126P5 25 Slides

Transglutaminase 5 (TGM5) CytoSection

Sign In for Pricing
View Details
Human GAL3 (Galectin-3) ELISA Kit
EKF57043 96 Tests

Human GAL3 (Galectin-3) ELISA Kit

Sign In for Pricing
View Details
F2 (Coagulation Factor II, Prothrombin)
126539 50 µg

F2 (Coagulation Factor II, Prothrombin)

Sign In for Pricing
View Details
Recombinant Mouse Carbonic Anhydrase X / Car10 Protein (His tag)
E53A06567 50 µg

Recombinant Mouse Carbonic Anhydrase X / Car10 Protein (His tag)

Sign In for Pricing
View Details
ITGB4 (Integrin beta-4, CD104) (MaxLight 750)
MBS6423304-01 0.1 mL

ITGB4 (Integrin beta-4, CD104) (MaxLight 750)

Sign In for Pricing
View Details