Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-1 alpha/CCL3, Rat

The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MIP-1 alpha/CCL3 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl3-protein-rat.html

Purity

95.0

Smiles

APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

Molecular Formula

25542 (Gene_ID) P50229 (A24-A92) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOPBP1 (pS1159) Antibody
abx219054 100 µg

TOPBP1 (pS1159) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal HBLD1 Antibody [Janelia Fluor 549]
NBP3-18410JF549 0.1 mL

Rabbit Polyclonal HBLD1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
EXT2 (NM_000401) Human Tagged Lenti ORF Clone
RC221426L2 10 µg

EXT2 (NM_000401) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olr213 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7442307 1.0 µg DNA

Olr213 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Healthy CD3 T Cells
HEA-CD3-50M 50 M Cells

Healthy CD3 T Cells

Sign In for Pricing
View Details
Recombinant Human Osteoprotegerin/TNFRSF11B Protein
NBP2-61323-500ug 500 µg

Recombinant Human Osteoprotegerin/TNFRSF11B Protein

Sign In for Pricing
View Details