Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-1 alpha/CCL3, Rat

The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MIP-1 alpha/CCL3 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl3-protein-rat.html

Purity

95.0

Smiles

APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

Molecular Formula

25542 (Gene_ID) P50229 (A24-A92) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP (Glial Fibrillary Acid Protein, Glial Marker, Glial Filament Protein)
301363 100 µg

GFAP (Glial Fibrillary Acid Protein, Glial Marker, Glial Filament Protein)

Request Quote
View Details
Anti-Human SLC10A1 Nanobody (SAA1145)
RHG93501 100 μg

Anti-Human SLC10A1 Nanobody (SAA1145)

Request Quote
View Details
ARL8A (NM_138795) Human Recombinant Protein
TP304596M 100 µg

ARL8A (NM_138795) Human Recombinant Protein

Request Quote
View Details
Carbonic anhydrase inhibitor 21
HY-158078 1 Each

Carbonic anhydrase inhibitor 21

Request Quote
View Details
Anti-HCLS1 Antibody
CQA2803-01 30 µL

Anti-HCLS1 Antibody

Request Quote
View Details
Anti-HCLS1 Antibody
CQA2803-02 50 μL

Anti-HCLS1 Antibody

Request Quote
View Details