Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-1 alpha/CCL3, Rat

The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MIP-1 alpha/CCL3 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl3-protein-rat.html

Purity

95.0

Smiles

APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

Molecular Formula

25542 (Gene_ID) P50229 (A24-A92) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin Light Chain 2 (MYL2) (1-166) Mouse Monoclonal Antibody [Clone ID: AT3B2]
AM09080PU-N 100 µL

Myosin Light Chain 2 (MYL2) (1-166) Mouse Monoclonal Antibody [Clone ID: AT3B2]

Sign In for Pricing
View Details
Mouse Caspase 10 (CASP10) ELISA kit
QY-E20279 96 Tests

Mouse Caspase 10 (CASP10) ELISA kit

Sign In for Pricing
View Details
C3orf52 (NM_024616) Human Tagged ORF Clone
RG229122 10 µg

C3orf52 (NM_024616) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tripeptidyl-Peptidase 2 (TPP2) Antibody
abx238896 100 µg

Tripeptidyl-Peptidase 2 (TPP2) Antibody

Sign In for Pricing
View Details
AcCoA Carboxylase 1 (ACC-1, Acetyl Coenzyme A Carboxylase 1)
MBS612438-01 0.1 mg

AcCoA Carboxylase 1 (ACC-1, Acetyl Coenzyme A Carboxylase 1)

Sign In for Pricing
View Details
AcCoA Carboxylase 1 (ACC-1, Acetyl Coenzyme A Carboxylase 1)
MBS612438-02 5x 0.1 mg

AcCoA Carboxylase 1 (ACC-1, Acetyl Coenzyme A Carboxylase 1)

Sign In for Pricing
View Details