Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-1 alpha/CCL3, Rat

The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MIP-1 alpha/CCL3 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl3-protein-rat.html

Purity

95.0

Smiles

APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

Molecular Formula

25542 (Gene_ID) P50229 (A24-A92) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibitor mmu-miR-7056-3p AAV miRNA Vector
Amm3165800 500 ng

Inhibitor mmu-miR-7056-3p AAV miRNA Vector

Sign In for Pricing
View Details
CSRP1 Antibody
DF3119-01 100 µL

CSRP1 Antibody

Sign In for Pricing
View Details
CSRP1 Antibody
DF3119-02 200 µL

CSRP1 Antibody

Sign In for Pricing
View Details
SMTN Adenovirus (Rat)
44480056 1.0 mL

SMTN Adenovirus (Rat)

Sign In for Pricing
View Details
(3-Phenyl-1H-inden-1-ylidene) bis (tricyclohexylphosphine) ruthenium (IV) Dichloride Tetrahydrofuran Adduct
sc-289227 100 mg

(3-Phenyl-1H-inden-1-ylidene) bis (tricyclohexylphosphine) ruthenium (IV) Dichloride Tetrahydrofuran Adduct

Sign In for Pricing
View Details
Fgf14 3'UTR Lenti-reporter-Luc Vector
20491086 1.0 µg

Fgf14 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details