Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-1 alpha/CCL3, Rat

The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MIP-1 alpha/CCL3 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl3-protein-rat.html

Purity

95.0

Smiles

APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

Molecular Formula

25542 (Gene_ID) P50229 (A24-A92) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPK alpha 1 (PRKAA1) (NM_206907) Human Tagged ORF Clone
RG224714 10 µg

AMPK alpha 1 (PRKAA1) (NM_206907) Human Tagged ORF Clone

Sign In for Pricing
View Details
ZNF732 ORF Vector (Human) (pORF)
ORF036379 1.0 µg DNA

ZNF732 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Atpif1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4587404 1.0 µg DNA

Atpif1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Mouse NFAT activation molecule 1 (NFAM1) ELISA Kit
abx255120 96 Tests

Mouse NFAT activation molecule 1 (NFAM1) ELISA Kit

Sign In for Pricing
View Details
Mouse anti-human IgA mAb (GA1)
A03B37-GA1 1 Each

Mouse anti-human IgA mAb (GA1)

Sign In for Pricing
View Details
Human AZGP1 Recombinant Protein
PPT-10775 100 µg

Human AZGP1 Recombinant Protein

Sign In for Pricing
View Details