Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-1 alpha/CCL3, Rat

The CCL3 protein is a single factor with inflammatory and chemotactic properties that attracts immune cells such as monocytes, neutrophils, eosinophils, basophils, and lymphocytes. It is critical in pulmonary TNF-α production, neutrophil recruitment, and lung injury and may serve as an autocrine mediator of TNF-α production by macrophages. MIP-1 alpha/CCL3 Protein, Rat is the recombinant rat-derived MIP-1 alpha/CCL3 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MIP-1 alpha/CCL3 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl3-protein-rat.html

Purity

95.0

Smiles

APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

Molecular Formula

25542 (Gene_ID) P50229 (A24-A92) (Accession)

Molecular Weight

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Metal Regulatory Transcription Factor 1 (MTF1), Recombinant, Mouse, His-Tag
049563-01 10 µg

Metal Regulatory Transcription Factor 1 (MTF1), Recombinant, Mouse, His-Tag

Ask
View Details
Metal Regulatory Transcription Factor 1 (MTF1), Recombinant, Mouse, His-Tag
049563-02 50 µg

Metal Regulatory Transcription Factor 1 (MTF1), Recombinant, Mouse, His-Tag

Ask
View Details
Metal Regulatory Transcription Factor 1 (MTF1), Recombinant, Mouse, His-Tag
049563-03 100 µg

Metal Regulatory Transcription Factor 1 (MTF1), Recombinant, Mouse, His-Tag

Ask
View Details
Metal Regulatory Transcription Factor 1 (MTF1), Recombinant, Mouse, His-Tag
049563-04 200 µg

Metal Regulatory Transcription Factor 1 (MTF1), Recombinant, Mouse, His-Tag

Ask
View Details
Ccnk Rat shRNA Plasmid (Locus ID 500715)
TR708137 1 Kit

Ccnk Rat shRNA Plasmid (Locus ID 500715)

Ask
View Details
Recombinant Mouse NADH-ubiquinone oxidoreductase chain 4L (Mtnd4l), partial
MBS7056319 Inquire

Recombinant Mouse NADH-ubiquinone oxidoreductase chain 4L (Mtnd4l), partial

Ask
View Details