Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1RAPL1, Mouse (HEK293, Fc)

IL1RAPL1 protein inhibits N-type calcium channels, regulates secretion, and activates JNK signaling. It promotes neurite growth and bidirectionally induces presynaptic and postsynaptic differentiation by binding to PTPRD during dendritic spine formation. IL1RAPL1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL1RAPL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

IL1RAPL1 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il1rapl1-protein-mouse-hek293-fc.html

Purity

98.0

Smiles

RGSADGCTDWSVDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKAWRPSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTVQETQLGGSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT

Molecular Formula

331461 (Gene_ID) P59823 (R25-T357) (Accession)

Molecular Weight

Approximately 85-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-3074-5p miRNA Inhibitor
CIM0722-01 10 nmol

Mmu-miR-3074-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-3074-5p miRNA Inhibitor
CIM0722-02 20 nmol

Mmu-miR-3074-5p miRNA Inhibitor

Sign In for Pricing
View Details
TNFRSF17 Antibody
A41280-50UL 50 μL

TNFRSF17 Antibody

Sign In for Pricing
View Details
Mki67 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4513204 1.0 µg DNA

Mki67 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Monoclonal Antibody to Human PD-L1 (Clone: ABM4E54)
10-7562-25 25 µg

Monoclonal Antibody to Human PD-L1 (Clone: ABM4E54)

Sign In for Pricing
View Details
EV-A71-IN-3
orb2944917-01 10 mg

EV-A71-IN-3

Sign In for Pricing
View Details