Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1

Product Specifications

Product Name Alternative

PT-Mice-Ins-beta NaTx6.1 (Tityustoxin VII) (Ts VII) (Ts7) (TsTX-VII) (Toxin II-11) (Toxin III-10) (Toxin T2-IV) (Toxin gamma) (TsTX-I)

Abbreviation

Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1 protein

UniProt

P15226

Expression Region

21-81aa

Organism

Tityus serrulatus (Brazilian scorpion)

Target Sequence

KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Beta toxins bind voltage-independently at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. In addition, it stimulates the release of NO, IL-6 and TNF-alpha in J774.1 cells. This toxin is active against both mammals and insects.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.3 kDa

References & Citations

"Amino acid sequence of toxin VII, a beta-toxin from the venom of the scorpion Tityus serrulatus." Bechis G., Sampieri F., Yuan P.-M., Brando T., Martin M.-F., Diniz C.R., Rochat H. Biochem. Biophys. Res. Commun. 122:1146-1153 (1984)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Nubpl shRNA (UAS) - Lentiviral mouse Nubpl shRNA (UAS, RFP) (25)
GTR15239951 1 Vial

Lentiviral mouse Nubpl shRNA (UAS) - Lentiviral mouse Nubpl shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
pCR4-TOPO-GML Plasmid
PVT25965 2 µg

pCR4-TOPO-GML Plasmid

Sign In for Pricing
View Details
C20orf194 Polyclonal Antibody, Biotin Conjugated
bs-9697R-Biotin 100 µL

C20orf194 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
SLC26A4 (NM_000441) Human Tagged Lenti ORF Clone
RC222532L3 10 µg

SLC26A4 (NM_000441) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Transcriptional repressor NrdR (nrdR)
MBS1158948-01 0.02 mg (E-Coli)

Recombinant Clostridium botulinum Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Transcriptional repressor NrdR (nrdR)
MBS1158948-02 0.1 mg (E-Coli)

Recombinant Clostridium botulinum Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details