Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1-Microglobulin, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Product Specifications

Product Name Alternative

Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html

Purity

95.0

Smiles

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Formula

259 (Gene_ID) P02760 (G20-V203) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GALNT7 shRNA Plasmid
abx979901-01 150 µg

Mouse GALNT7 shRNA Plasmid

Sign In for Pricing
View Details
Mouse GALNT7 shRNA Plasmid
abx979901-02 300 µg

Mouse GALNT7 shRNA Plasmid

Sign In for Pricing
View Details
Anti-APC IgG 2a isotype control (Mouse, Monoclonal)
A108887 100 µL

Anti-APC IgG 2a isotype control (Mouse, Monoclonal)

Sign In for Pricing
View Details
Lentiviral mouse Rab3gap1 shRNA (UAS) - Lentiviral mouse Rab3gap1 shRNA (UAS, RFP) (25)
GTR15196379 1 Vial

Lentiviral mouse Rab3gap1 shRNA (UAS) - Lentiviral mouse Rab3gap1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rabbit Monoclonal Vinculin Antibody (VCL/7091R)
NBP3-13989-20ug 20 µg

Rabbit Monoclonal Vinculin Antibody (VCL/7091R)

Sign In for Pricing
View Details
MRPL9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1326705 3x 1.0 µg

MRPL9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details