Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1-Microglobulin, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Product Specifications

Product Name Alternative

Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html

Purity

95.0

Smiles

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Formula

259 (Gene_ID) P02760 (G20-V203) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-XRCC1 (Thr284) Blocking Peptide
MBS9619476-01 1 mg

Phospho-XRCC1 (Thr284) Blocking Peptide

Sign In for Pricing
View Details
Phospho-XRCC1 (Thr284) Blocking Peptide
MBS9619476-02 5x 1 mg

Phospho-XRCC1 (Thr284) Blocking Peptide

Sign In for Pricing
View Details
SFSWAP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV662125 1.0 µg DNA

SFSWAP Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
(E)-N-(4-Bromophenyl)-3-phenyl-2-propenamide
MBS6100153-01 500 mg

(E)-N-(4-Bromophenyl)-3-phenyl-2-propenamide

Sign In for Pricing
View Details
(E)-N-(4-Bromophenyl)-3-phenyl-2-propenamide
MBS6100153-02 5x 500 mg

(E)-N-(4-Bromophenyl)-3-phenyl-2-propenamide

Sign In for Pricing
View Details
Recombinant Mouse Cathepsin D/CTSD Protein (His Tag)
PKSM041238 50 µg

Recombinant Mouse Cathepsin D/CTSD Protein (His Tag)

Sign In for Pricing
View Details