Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1-Microglobulin, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Product Specifications

Product Name Alternative

Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html

Purity

95.0

Smiles

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Formula

259 (Gene_ID) P02760 (G20-V203) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ano2 (NM_153589) Mouse Tagged Lenti ORF Clone
MR219751L4 10 µg

Ano2 (NM_153589) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DNA cross-link repair 1C (DCLRE1C, PSO2, artemis) polyclonal antibody
ABP-PAB-10241 100 ug

DNA cross-link repair 1C (DCLRE1C, PSO2, artemis) polyclonal antibody

Sign In for Pricing
View Details
anti-EPCR/CD201
YF-PA17047 100 ul

anti-EPCR/CD201

Sign In for Pricing
View Details
VPS4B Rabbit pAb (APR22333N)
APR22333N-01 50 µL

VPS4B Rabbit pAb (APR22333N)

Sign In for Pricing
View Details
VPS4B Rabbit pAb (APR22333N)
APR22333N-02 100 µL

VPS4B Rabbit pAb (APR22333N)

Sign In for Pricing
View Details
VPS4B Rabbit pAb (APR22333N)
APR22333N-03 200 µL

VPS4B Rabbit pAb (APR22333N)

Sign In for Pricing
View Details