Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1-Microglobulin, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Product Specifications

Product Name Alternative

Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html

Purity

95.0

Smiles

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Formula

259 (Gene_ID) P02760 (G20-V203) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fractalkine/CX3CL1, Human
Z03305-5 5 μg

Fractalkine/CX3CL1, Human

Sign In for Pricing
View Details
Med27 (NM_026896) Mouse Tagged Lenti ORF Clone
MR224500L4 10 µg

Med27 (NM_026896) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RNU5E-1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
40411061 1.0 µg DNA

RNU5E-1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
WBSCR22 CRISPRa sgRNA lentivector (set of three targets)(Human)
50285121 3x 1.0µg DNA

WBSCR22 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Anti-Mouse CD2/LFA-2 FITC Conjugate Antibody
MBS4151542-01 0.1 mg

Anti-Mouse CD2/LFA-2 FITC Conjugate Antibody

Sign In for Pricing
View Details
Anti-Mouse CD2/LFA-2 FITC Conjugate Antibody
MBS4151542-02 5x 0.1 mg

Anti-Mouse CD2/LFA-2 FITC Conjugate Antibody

Sign In for Pricing
View Details