Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1-Microglobulin, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Product Specifications

Product Name Alternative

Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html

Purity

95.0

Smiles

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Formula

259 (Gene_ID) P02760 (G20-V203) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PSTPIP1 Protein
E30P4648 20 µg

Recombinant Human PSTPIP1 Protein

Sign In for Pricing
View Details
Pan Phospho-Tyrosine Rabbit mAb
AP1316-01 20 µL

Pan Phospho-Tyrosine Rabbit mAb

Sign In for Pricing
View Details
Pan Phospho-Tyrosine Rabbit mAb
AP1316-02 100 μL

Pan Phospho-Tyrosine Rabbit mAb

Sign In for Pricing
View Details
Pan Phospho-Tyrosine Rabbit mAb
AP1316-03 500 μL

Pan Phospho-Tyrosine Rabbit mAb

Sign In for Pricing
View Details
Pan Phospho-Tyrosine Rabbit mAb
AP1316-04 1000 μL

Pan Phospho-Tyrosine Rabbit mAb

Sign In for Pricing
View Details
Tumor Necrosis Factor beta, Recombinant, Human, aa35-205, His-Tag (TNFb) discontinued
T9160-41C 10 µg

Tumor Necrosis Factor beta, Recombinant, Human, aa35-205, His-Tag (TNFb) discontinued

Sign In for Pricing
View Details