Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1-Microglobulin, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Product Specifications

Product Name Alternative

Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html

Purity

95.0

Smiles

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Formula

259 (Gene_ID) P02760 (G20-V203) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLX3 Recombinant Antibody, FITC Conjugated
bsm-62683R-FITC 100 µL

DLX3 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
LOC364084 3'UTR Luciferase Stable Cell Line
TU210024 1.0 mL

LOC364084 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human PAXBP1 shRNA (UAS) - Lentiviral human PAXBP1 shRNA (UAS, iRFP) (25)
GTR15089054 1 Vial

Lentiviral human PAXBP1 shRNA (UAS) - Lentiviral human PAXBP1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
CD235a antibody (FITC)
MBS5318009-01 100 Pieces

CD235a antibody (FITC)

Sign In for Pricing
View Details
CD235a antibody (FITC)
MBS5318009-02 5x 100 Pieces

CD235a antibody (FITC)

Sign In for Pricing
View Details
FIM3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0783706 1.0 µg DNA

FIM3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details