Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1-Microglobulin, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Product Specifications

Product Name Alternative

Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html

Purity

95.0

Smiles

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Formula

259 (Gene_ID) P02760 (G20-V203) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR7E149P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV772470 1.0 µg DNA

OR7E149P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Alkbh3 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6345404 1.0 µg DNA

Alkbh3 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
S26A5 Polyclonal Antibody
JOT-AP14006-01 50ul

S26A5 Polyclonal Antibody

Sign In for Pricing
View Details
S26A5 Polyclonal Antibody
JOT-AP14006-02 100ul

S26A5 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Sahara scorpion AaH II/Neurotoxin II Nanobody (SAA2040)
RWN10303 100 μg

Anti-Sahara scorpion AaH II/Neurotoxin II Nanobody (SAA2040)

Sign In for Pricing
View Details
Human RNF166 siRNA
abx904610-01 15 nmol

Human RNF166 siRNA

Sign In for Pricing
View Details