Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1-Microglobulin, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Product Specifications

Product Name Alternative

Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html

Purity

95.0

Smiles

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Formula

259 (Gene_ID) P02760 (G20-V203) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isopropyl acetate
S-2305 1 mL

Isopropyl acetate

Sign In for Pricing
View Details
Mouse Monoclonal PCNA Antibody (PCNA/694) - Azide and BSA Free
NBP2-47835-0.1mg 0.1 mg

Mouse Monoclonal PCNA Antibody (PCNA/694) - Azide and BSA Free

Sign In for Pricing
View Details
Ywhab Mouse siRNA Oligo Duplex (Locus ID 54401)
SR406888 1 Kit

Ywhab Mouse siRNA Oligo Duplex (Locus ID 54401)

Sign In for Pricing
View Details
CD134 Recombinant Rabbit monoclonal Antibody
HA751343 100 µL

CD134 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Trem3 Recombinant Protein (Rat)
RP234593 100 µg

Trem3 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Recombinant Human PGAM1 Protein, N-His
YHD30501 100 μg

Recombinant Human PGAM1 Protein, N-His

Sign In for Pricing
View Details