Alpha 1-Microglobulin, Human (HEK293, His)
Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].
Product Specifications
Product Name Alternative
Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html
Purity
95.0
Smiles
GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH
Molecular Formula
259 (Gene_ID) P02760 (G20-V203) (Accession)
Molecular Weight
Approximately 33.0 kDa
References & Citations
[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
H2009-02B 100 µg
Hepcidin, pro, Human, Control Peptide (Pro Hepc, LEAP, Hepatic Bactericidal Protein, Liver Expressed Antimicrobial Peptide) Control Peptide
Sign In for Pricing
View Details RC205058L1V 200 µL
ARSF (NM_004042) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
K0452807 1.0 µg DNA
CIB2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 
RR205463L4V 200 µL
Mxi1 (NM_013160) Rat Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details