Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1-Microglobulin, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Product Specifications

Product Name Alternative

Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html

Purity

95.0

Smiles

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Formula

259 (Gene_ID) P02760 (G20-V203) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC30A10 (NM_018713) AAV Particle
RC220219A1V 250 µL

Human SLC30A10 (NM_018713) AAV Particle

Sign In for Pricing
View Details
Rat Monoclonal S100A8 Antibody (63N13G5) [DyLight 488]
NBP2-27067G 0.1 mL

Rat Monoclonal S100A8 Antibody (63N13G5) [DyLight 488]

Sign In for Pricing
View Details
ZNF676 AAV siRNA Pooled Vector
51720161 1.0 µg

ZNF676 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Anti-Chlamydia trachomatis MOMP Antibody
15156-1000 1 Each

Anti-Chlamydia trachomatis MOMP Antibody

Sign In for Pricing
View Details
Olr283 (NM_001001010) Rat Tagged ORF Clone Lentiviral Particle
RR201183L4V 200 µL

Olr283 (NM_001001010) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
M-CSF (CSF1) Human shRNA Lentiviral Particle (Locus ID 1435)
TL305200V 500 µL Each

M-CSF (CSF1) Human shRNA Lentiviral Particle (Locus ID 1435)

Sign In for Pricing
View Details