Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1-Microglobulin, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Product Specifications

Product Name Alternative

Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html

Purity

95.0

Smiles

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Formula

259 (Gene_ID) P02760 (G20-V203) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2A13P sgRNA CRISPR Lentivector (Human) (Target 3)
K1490504 1.0 µg DNA

OR2A13P sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-Mouse 4-1BB Antibody (3H3)
MBS5822243 Inquire

Anti-Mouse 4-1BB Antibody (3H3)

Sign In for Pricing
View Details
ADRA1A Antibody
MBS7112739-01 0.05 mL

ADRA1A Antibody

Sign In for Pricing
View Details
ADRA1A Antibody
MBS7112739-02 0.1 mL

ADRA1A Antibody

Sign In for Pricing
View Details
ADRA1A Antibody
MBS7112739-03 5x 0.1 mL

ADRA1A Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Chikungunya Virus Antibody (6A11)
NBP2-53111 0.1 mg

Mouse Monoclonal Chikungunya Virus Antibody (6A11)

Sign In for Pricing
View Details