Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1-Microglobulin, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Product Specifications

Product Name Alternative

Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html

Purity

95.0

Smiles

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Formula

259 (Gene_ID) P02760 (G20-V203) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GEFT (ARHGEF25) (NM_182947) Human Over-expression Lysate
LS115557-100ug 100 µg

GEFT (ARHGEF25) (NM_182947) Human Over-expression Lysate

Sign In for Pricing
View Details
LIF, Human (HEK293, Fc)
HY-P73277-01 10 µg

LIF, Human (HEK293, Fc)

Sign In for Pricing
View Details
LIF, Human (HEK293, Fc)
HY-P73277-02 50 µg

LIF, Human (HEK293, Fc)

Sign In for Pricing
View Details
LIF, Human (HEK293, Fc)
HY-P73277-03 100 µg

LIF, Human (HEK293, Fc)

Sign In for Pricing
View Details
Human ADAM2 qPCR Primer Pair
QH14501S 200 Tests

Human ADAM2 qPCR Primer Pair

Sign In for Pricing
View Details
Depdc1a (NM_001172093) Mouse Tagged Lenti ORF Clone
MR218188L4 10 µg

Depdc1a (NM_001172093) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details