Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1-Microglobulin, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Product Specifications

Product Name Alternative

Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html

Purity

95.0

Smiles

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Formula

259 (Gene_ID) P02760 (G20-V203) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyl-Histone H2A (Lys9) Rabbit Monoclonal Antibody
AF1207 50 µL

Acetyl-Histone H2A (Lys9) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Shewanella sp. LexA repressor (lexA)
MBS1330241-01 0.02 mg (E-Coli)

Recombinant Shewanella sp. LexA repressor (lexA)

Sign In for Pricing
View Details
Recombinant Shewanella sp. LexA repressor (lexA)
MBS1330241-02 0.1 mg (E-Coli)

Recombinant Shewanella sp. LexA repressor (lexA)

Sign In for Pricing
View Details
Recombinant Shewanella sp. LexA repressor (lexA)
MBS1330241-03 0.02 mg (Yeast)

Recombinant Shewanella sp. LexA repressor (lexA)

Sign In for Pricing
View Details
Recombinant Shewanella sp. LexA repressor (lexA)
MBS1330241-04 0.1 mg (Yeast)

Recombinant Shewanella sp. LexA repressor (lexA)

Sign In for Pricing
View Details
Recombinant Shewanella sp. LexA repressor (lexA)
MBS1330241-05 0.02 mg (Baculovirus)

Recombinant Shewanella sp. LexA repressor (lexA)

Sign In for Pricing
View Details