Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha 1-Microglobulin, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Product Specifications

Product Name Alternative

Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html

Purity

95.0

Smiles

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Formula

259 (Gene_ID) P02760 (G20-V203) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bccip (NM_025392) Mouse Tagged Lenti ORF Clone
MR204529L4 10 µg

Bccip (NM_025392) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OBFC2B (NABP2) Human qPCR Template Standard (NM_024068)
HK205284 1 Kit

OBFC2B (NABP2) Human qPCR Template Standard (NM_024068)

Sign In for Pricing
View Details
Pcna (NM_011045) Mouse Tagged Lenti ORF Clone
MR203392L3 10 µg

Pcna (NM_011045) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tyro3 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6885303 1.0 µg DNA

Tyro3 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
ACOX3 (NM_003501) Human Over-expression Lysate
LC401181 20 µg

ACOX3 (NM_003501) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Proteus mirabilis UPF0260 protein PMI1174 (PMI1174)
MBS1243052-01 0.02 mg (E-Coli)

Recombinant Proteus mirabilis UPF0260 protein PMI1174 (PMI1174)

Sign In for Pricing
View Details