Alpha 1-Microglobulin, Human (HEK293, His)
Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].
Product Specifications
Product Name Alternative
Alpha 1-Microglobulin Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/alpha-1-microglobulin-protein-human-hek293-his.html
Purity
95.0
Smiles
GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH
Molecular Formula
259 (Gene_ID) P02760 (G20-V203) (Accession)
Molecular Weight
Approximately 33.0 kDa
References & Citations
[1]B Akerström, et al. alpha (1) -Microglobulin: a yellow-brown lipocalin. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2) :172-84.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15375462 1 Vial
Lentiviral human TSPAN15 sgRNA gene knockout kit - Lentiviral human TSPAN15 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details MBS6370714-01 0.1 mL
ATP5H (ATP Synthase Subunit D, Mitochondrial, ATPase Subunit D, My032) (MaxLight 750)
Sign In for Pricing
View Details MBS6370714-02 5x 0.1 mL
ATP5H (ATP Synthase Subunit D, Mitochondrial, ATPase Subunit D, My032) (MaxLight 750)
Sign In for Pricing
View Details 