Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF10C, Human (HEK293, His)

The TNFRSF10C protein is a receptor for TRAIL and lacks a cytoplasmic death domain, making it unable to induce apoptosis. Instead, it protects cells by competing for ligand binding with TRAIL-R1 and R2, acting as a decoy receptor and mitigating TRAIL-mediated apoptosis. TNFRSF10C Protein, Human (HEK293, His) is the recombinant human-derived TNFRSF10C protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TNFRSF10C Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf10c-protein-human-hek-293-his.html

Purity

95.00

Smiles

ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA

Molecular Formula

8794 (Gene_ID) O14798 (A26-A221) (Accession)

Molecular Weight

50-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-TGM1
YF-PA27379 100 ul

anti-TGM1

Sign In for Pricing
View Details
Mouse Per3 (NM_001289878) AAV Particle
MR231176A1V 250 µL

Mouse Per3 (NM_001289878) AAV Particle

Sign In for Pricing
View Details
Mouse Monoclonal beta-Catenin Antibody (CTNNB1/1509) [HRP]
NBP2-54540H 100 µL

Mouse Monoclonal beta-Catenin Antibody (CTNNB1/1509) [HRP]

Sign In for Pricing
View Details
ING2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B11]
TA800661AM 100 µL

ING2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B11]

Sign In for Pricing
View Details
anti-Fos B
YF-PA11841 50 ul

anti-Fos B

Sign In for Pricing
View Details
Hexokinase-1 Human Recombinant
rAP-1153 1 Each

Hexokinase-1 Human Recombinant

Sign In for Pricing
View Details