Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 5 (GDF5) (Active)

Product Specifications

Product Name Alternative

BMP14, CDMP1, GDF-5, BMP-14, CDMP-1, LAP-4, LPS-associated protein 4, Radotermin

Abbreviation

Recombinant Human GDF5 protein (Active)

Gene Name

GDF5

UniProt

P43026

Expression Region

382-501aa

Organism

Homo sapiens (Human)

Target Sequence

APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Signal Transduction

Relevance

Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue through its binding of high affinity with BMPR1B and of less affinity with BMPR1A, leading to induction of SMAD1-SMAD5-SMAD8 complex phosphorylation and then SMAD protein signaling transduction (PubMed:24098149, PubMed:21976273, PubMed:15530414, PubMed:25092592) . Secondly, negatively regulates chondrogenic differentiation through its interaction with NOG (PubMed:21976273) . Required to prevent excessive muscle loss upon denervation. This function requires SMAD4 and is mediated by phosphorylated SMAD1/5/8 (By similarity) . Binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory response, including TNF secretion by monocytes (PubMed:11276205) .

Endotoxin

Less than 0.1 EU/µg as determined by LAL method.

Purity

>95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AceSeqTM Urine DNA Kit
AG024Z 1 Kit

AceSeqTM Urine DNA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ZC3H12D Antibody
NBP2-98171-50ul 50 µL

Rabbit Polyclonal ZC3H12D Antibody

Sign In for Pricing
View Details
MDM2 Antibody, HRP conjugated
CSB-PA11628B0Rb-01 50 μL

MDM2 Antibody, HRP conjugated

Sign In for Pricing
View Details
MDM2 Antibody, HRP conjugated
CSB-PA11628B0Rb-02 100 µL

MDM2 Antibody, HRP conjugated

Sign In for Pricing
View Details
DGLB Antibody
MBS9519914-01 0.04 mL

DGLB Antibody

Sign In for Pricing
View Details
DGLB Antibody
MBS9519914-02 0.1 mL

DGLB Antibody

Sign In for Pricing
View Details