Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRAS, Human (His, solution)

NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (His, solution) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NRAS Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nras-protein-human-his.html

Purity

95.20

Smiles

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC

Molecular Formula

4893 (Gene_ID) P01111 (M1-C186) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAG-2 (Recombination Activating Gene 2) Rabbit ELISA Kit
G6204 96 Tests

RAG-2 (Recombination Activating Gene 2) Rabbit ELISA Kit

Sign In for Pricing
View Details
MPRγ Polyclonal Antibody
RA27358-01 50 µL

MPRγ Polyclonal Antibody

Sign In for Pricing
View Details
MPRγ Polyclonal Antibody
RA27358-02 100 µL

MPRγ Polyclonal Antibody

Sign In for Pricing
View Details
PKC α Polyclonal Antibody
RA28798-01 50 µL

PKC α Polyclonal Antibody

Sign In for Pricing
View Details
PKC α Polyclonal Antibody
RA28798-02 100 µL

PKC α Polyclonal Antibody

Sign In for Pricing
View Details
Human IL1RL1/ST2 ELISA Kit
orb1657992 96 Tests

Human IL1RL1/ST2 ELISA Kit

Sign In for Pricing
View Details