Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRAS, Human (His, solution)

NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (His, solution) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NRAS Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nras-protein-human-his.html

Purity

95.20

Smiles

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC

Molecular Formula

4893 (Gene_ID) P01111 (M1-C186) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Noggin (NOG)
MBS2003659-01 0.1 mL

Polyclonal Antibody to Noggin (NOG)

Sign In for Pricing
View Details
Polyclonal Antibody to Noggin (NOG)
MBS2003659-02 0.2 mL

Polyclonal Antibody to Noggin (NOG)

Sign In for Pricing
View Details
Polyclonal Antibody to Noggin (NOG)
MBS2003659-03 0.5 mL

Polyclonal Antibody to Noggin (NOG)

Sign In for Pricing
View Details
Polyclonal Antibody to Noggin (NOG)
MBS2003659-04 1 mL

Polyclonal Antibody to Noggin (NOG)

Sign In for Pricing
View Details
Polyclonal Antibody to Noggin (NOG)
MBS2003659-05 5 mL

Polyclonal Antibody to Noggin (NOG)

Sign In for Pricing
View Details
Polyclonal Antibody to Noggin (NOG)
MBS2003659-06 5x 5 mL

Polyclonal Antibody to Noggin (NOG)

Sign In for Pricing
View Details