Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRAS, Human (His, solution)

NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (His, solution) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NRAS Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nras-protein-human-his.html

Purity

95.20

Smiles

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC

Molecular Formula

4893 (Gene_ID) P01111 (M1-C186) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2C1 ORF Vector (Human) (pORF)
32130011 1.0 µg DNA

NR2C1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris NADH-quinone oxidoreductase subunit K (nuoK)
MBS7024221-01 0.02 mg

Recombinant Xanthomonas campestris pv. campestris NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris NADH-quinone oxidoreductase subunit K (nuoK)
MBS7024221-02 0.1 mg

Recombinant Xanthomonas campestris pv. campestris NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris NADH-quinone oxidoreductase subunit K (nuoK)
MBS7024221-03 5x 0.1 mg

Recombinant Xanthomonas campestris pv. campestris NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
GENLISA™ Bovine Heat Shock Protein 90 (HSP90) ELISA
KLB2335 1x 96 Well

GENLISA™ Bovine Heat Shock Protein 90 (HSP90) ELISA

Sign In for Pricing
View Details
Rabbit Anti Human IgG (H+L)
MBS460722-01 0.5 mg

Rabbit Anti Human IgG (H+L)

Sign In for Pricing
View Details