Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-6, Human (HEK293, Fc)

Siglec-6 Protein, a putative adhesion molecule, facilitates sialic acid-dependent binding to cells, specifically binding to alpha-2,6-linked sialic acid. Its sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Siglec-6 interacts with LEP. Siglec-6 Protein, Human (HEK293, Fc) is the recombinant human-derived Siglec-6 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-6 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-6-protein-human-hek-293-fc.html

Purity

95.0

Smiles

ERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGV

Molecular Formula

946 (Gene_ID) O43699-3 (Q27-V331) (Accession)

Molecular Weight

70-90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP4S1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV630101 1.0 µg DNA

AP4S1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Stat4 Double Nickase Plasmid (h)
sc-416749-NIC 20 µg

Stat4 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
P2rx7 (NM_019256) Rat Tagged ORF Clone
RR203697 10 µg

P2rx7 (NM_019256) Rat Tagged ORF Clone

Sign In for Pricing
View Details
2-Deoxy-2'-deoxy-5'- (4,4'-dimethoxytrityl) uridine
orb1907445-01 5 mg

2-Deoxy-2'-deoxy-5'- (4,4'-dimethoxytrityl) uridine

Sign In for Pricing
View Details
2-Deoxy-2'-deoxy-5'- (4,4'-dimethoxytrityl) uridine
orb1907445-02 10 mg

2-Deoxy-2'-deoxy-5'- (4,4'-dimethoxytrityl) uridine

Sign In for Pricing
View Details
2-Deoxy-2'-deoxy-5'- (4,4'-dimethoxytrityl) uridine
orb1907445-03 25 mg

2-Deoxy-2'-deoxy-5'- (4,4'-dimethoxytrityl) uridine

Sign In for Pricing
View Details