Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYDGF, Human (His)

The MYDGF protein is derived from bone marrow mononuclear cells and significantly promotes cardioprotection and post-myocardial infarction (MI) repair. Its functions include promoting cardiomyocyte survival and promoting adaptive angiogenesis. MYDGF Protein, Human (His) is the recombinant human-derived MYDGF protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MYDGF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mydgf-protein-human-his.html

Purity

98.0

Smiles

SEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL

Molecular Formula

56005 (Gene_ID) Q969H8 (S33-L173) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Chemokine (C motif) ligand (Lptn; LTN; XCL1) ELISA Kit
JL11103-01 48 Tests

Mouse Chemokine (C motif) ligand (Lptn; LTN; XCL1) ELISA Kit

Ask
View Details
Mouse Chemokine (C motif) ligand (Lptn; LTN; XCL1) ELISA Kit
JL11103-02 96 Tests

Mouse Chemokine (C motif) ligand (Lptn; LTN; XCL1) ELISA Kit

Ask
View Details
Proto-oncogene tyrosine-protein kinase Src
E58P1086 50 µg

Proto-oncogene tyrosine-protein kinase Src

Ask
View Details
PPP1R13B, ID (PPP1R13B, ASPP1, KIAA0771, Apoptosis-stimulating of p53 protein 1, Protein phosphatase 1 regulatory subunit 13B)
MBS6003952-01 0.2 mL

PPP1R13B, ID (PPP1R13B, ASPP1, KIAA0771, Apoptosis-stimulating of p53 protein 1, Protein phosphatase 1 regulatory subunit 13B)

Ask
View Details
PPP1R13B, ID (PPP1R13B, ASPP1, KIAA0771, Apoptosis-stimulating of p53 protein 1, Protein phosphatase 1 regulatory subunit 13B)
MBS6003952-02 5x 0.2 mL

PPP1R13B, ID (PPP1R13B, ASPP1, KIAA0771, Apoptosis-stimulating of p53 protein 1, Protein phosphatase 1 regulatory subunit 13B)

Ask
View Details
Recombinant Macaca fascicularis Tetratricopeptide repeat protein 12 (TTC12), partial
MBS1398289 Inquire

Recombinant Macaca fascicularis Tetratricopeptide repeat protein 12 (TTC12), partial

Ask
View Details