Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O157:H7 mRNA interferase MazF (mazF)

Product Specifications

Product Name Alternative

(Toxin MazF) (mRNA interferase MazF)

Abbreviation

Recombinant E.coli O157:H7 mazF protein

Gene Name

MazF

UniProt

P0AE71

Expression Region

1-111aa

Organism

Escherichia coli O157:H7

Target Sequence

MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Toxic component of a type II toxin-antitoxin (TA) system. MazF is a sequence-specific endoribonuclease that inhibits protein synthesis and induces bacterial stasis. It is very stable, single-strand specific and cleavage is independent of the ribosome. The endoribonuclease activity (a toxin) is inhibited by the labile cognate antitoxin MazE. Toxicity results when the levels of MazE decrease in the cell, leading to mRNA degradation. Both MazE and MazE-MazF bind to the promoter region of the mazE-mazF operon to inhibit their transcription.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.4 kDa

References & Citations

"Genome sequence of enterohaemorrhagic Escherichia coli O157:H7." Perna N.T., Plunkett G. III, Burland V., Mau B., Glasner J.D., Rose D.J., Mayhew G.F., Evans P.S., Gregor J., Kirkpatrick H.A., Posfai G., Hackett J., Klink S., Boutin A., Shao Y., Miller L., Grotbeck E.J., Davis N.W. Blattner F.R. Nature 409:529-533 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KASH5 (NM_144688) Human Untagged Clone
SC314302 10 µg

KASH5 (NM_144688) Human Untagged Clone

Sign In for Pricing
View Details
Human Epididymis Protein 4 (HE4)
MBS319621-01 1 mg

Human Epididymis Protein 4 (HE4)

Sign In for Pricing
View Details
Human Epididymis Protein 4 (HE4)
MBS319621-02 5x 1 mg

Human Epididymis Protein 4 (HE4)

Sign In for Pricing
View Details
RAC2 (1-189) mouse monoclonal antibody, clone AT2G11, Purified
AM39043PU-S 50 µL

RAC2 (1-189) mouse monoclonal antibody, clone AT2G11, Purified

Sign In for Pricing
View Details
NDUFA10 Antibody (Rabbit Polyclonal)
MBS8508587-01 0.2 mL

NDUFA10 Antibody (Rabbit Polyclonal)

Sign In for Pricing
View Details
NDUFA10 Antibody (Rabbit Polyclonal)
MBS8508587-02 0.1 mL (AF405L)

NDUFA10 Antibody (Rabbit Polyclonal)

Sign In for Pricing
View Details