Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Mouse (CHO)

G-CSF Protein, Mouse (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

Product Specifications

Product Name Alternative

G-CSF Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-mouse-cho.html

Purity

97.00

Smiles

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Molecular Formula

12985 (Gene_ID) P09920 (V31-A208) (Accession)

Molecular Weight

Approximately 21-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Demetri GD, et al. Granulocyte Colony Stimulating Factor and its receptor. Blood. 1991 Dec 1;78 (11) :2791-808.|[2]Shah J, et al. The clinical use of granulocyte-colony stimulating factor. Br J Hosp Med (Lond) . 2014 Feb;75 (2) :C29-32.|[3]Panopoulos AD, et al. Granulocyte colony-stimulating factor: molecular mechanisms of action during steady state and 'emergency' hematopoiesis. Cytokine. 2008 Jun;42 (3) :277-88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Escherichia coli O7:K1 UPF0345 protein YaiE (yaiE)
MBS1220763-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O7:K1 UPF0345 protein YaiE (yaiE)

Ask
View Details
Recombinant Escherichia coli O7:K1 UPF0345 protein YaiE (yaiE)
MBS1220763-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O7:K1 UPF0345 protein YaiE (yaiE)

Ask
View Details
Recombinant Escherichia coli O7:K1 UPF0345 protein YaiE (yaiE)
MBS1220763-03 0.02 mg (Yeast)

Recombinant Escherichia coli O7:K1 UPF0345 protein YaiE (yaiE)

Ask
View Details
Recombinant Escherichia coli O7:K1 UPF0345 protein YaiE (yaiE)
MBS1220763-04 0.1 mg (Yeast)

Recombinant Escherichia coli O7:K1 UPF0345 protein YaiE (yaiE)

Ask
View Details
Recombinant Escherichia coli O7:K1 UPF0345 protein YaiE (yaiE)
MBS1220763-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O7:K1 UPF0345 protein YaiE (yaiE)

Ask
View Details
Recombinant Escherichia coli O7:K1 UPF0345 protein YaiE (yaiE)
MBS1220763-06 1 mg (E-Coli)

Recombinant Escherichia coli O7:K1 UPF0345 protein YaiE (yaiE)

Ask
View Details