Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Mouse (CHO)

G-CSF Protein, Mouse (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

Product Specifications

Product Name Alternative

G-CSF Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-mouse-cho.html

Purity

97.00

Smiles

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Molecular Formula

12985 (Gene_ID) P09920 (V31-A208) (Accession)

Molecular Weight

Approximately 21-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Demetri GD, et al. Granulocyte Colony Stimulating Factor and its receptor. Blood. 1991 Dec 1;78 (11) :2791-808.|[2]Shah J, et al. The clinical use of granulocyte-colony stimulating factor. Br J Hosp Med (Lond) . 2014 Feb;75 (2) :C29-32.|[3]Panopoulos AD, et al. Granulocyte colony-stimulating factor: molecular mechanisms of action during steady state and 'emergency' hematopoiesis. Cytokine. 2008 Jun;42 (3) :277-88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SARS-CoV-2 S Protein Nanobody
E55A13184 100 µg

SARS-CoV-2 S Protein Nanobody

Ask
View Details
Rdh2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
38771126 3x 1.0µg DNA

Rdh2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details
Mouse recombinant CXCL7 (40-113) (C-X-C motif chemokine 7) protein, AF
PROTQ9EQI5-100ug 100 µg

Mouse recombinant CXCL7 (40-113) (C-X-C motif chemokine 7) protein, AF

Ask
View Details
Mouse monoclonal antibody to HPV-18 E2, clone 2E7
A2-401-100-01 100 µg

Mouse monoclonal antibody to HPV-18 E2, clone 2E7

Ask
View Details
Mouse monoclonal antibody to HPV-18 E2, clone 2E7
A2-401-100-02 500 µg

Mouse monoclonal antibody to HPV-18 E2, clone 2E7

Ask
View Details
Mouse monoclonal antibody to HPV-18 E2, clone 2E7
A2-401-100-03 1 mg

Mouse monoclonal antibody to HPV-18 E2, clone 2E7

Ask
View Details