What is the catalog number for G-CSF, Mouse (CHO)?

The catalog number for G-CSF, Mouse (CHO) is HY-P7068.

What sizes are available for G-CSF, Mouse (CHO)?

G-CSF, Mouse (CHO) is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg, 250 µg, 500 µg, 1 mg.

How many pack sizes does G-CSF, Mouse (CHO) come in?

G-CSF, Mouse (CHO) is available in 7 different pack sizes.

Is G-CSF, Mouse (CHO) in stock?

G-CSF, Mouse (CHO) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures G-CSF, Mouse (CHO)?

G-CSF, Mouse (CHO) is manufactured by QuantiMol.

What is the estimated delivery time for G-CSF, Mouse (CHO)?

Estimated delivery time for G-CSF, Mouse (CHO) is approximately 15 business day(s), depending on your location.

G-CSF, Mouse (CHO)

G-CSF Protein, Mouse (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

Product Specifications

Product Name Alternative

G-CSF Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-mouse-cho.html

Purity

97.00

Smiles

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Molecular Formula

12985 (Gene_ID) P09920 (V31-A208) (Accession)

Molecular Weight

Approximately 21-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Demetri GD, et al. Granulocyte Colony Stimulating Factor and its receptor. Blood. 1991 Dec 1;78 (11) :2791-808.|[2]Shah J, et al. The clinical use of granulocyte-colony stimulating factor. Br J Hosp Med (Lond) . 2014 Feb;75 (2) :C29-32.|[3]Panopoulos AD, et al. Granulocyte colony-stimulating factor: molecular mechanisms of action during steady state and 'emergency' hematopoiesis. Cytokine. 2008 Jun;42 (3) :277-88.