Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Mouse (CHO)

G-CSF Protein, Mouse (CHO) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

Product Specifications

Product Name Alternative

G-CSF Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-mouse-cho.html

Purity

97.00

Smiles

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Molecular Formula

12985 (Gene_ID) P09920 (V31-A208) (Accession)

Molecular Weight

Approximately 21-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Demetri GD, et al. Granulocyte Colony Stimulating Factor and its receptor. Blood. 1991 Dec 1;78 (11) :2791-808.|[2]Shah J, et al. The clinical use of granulocyte-colony stimulating factor. Br J Hosp Med (Lond) . 2014 Feb;75 (2) :C29-32.|[3]Panopoulos AD, et al. Granulocyte colony-stimulating factor: molecular mechanisms of action during steady state and 'emergency' hematopoiesis. Cytokine. 2008 Jun;42 (3) :277-88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal beta COP Antibody [Alexa Fluor 488]
NBP2-41358AF488 0.1 mL

Rabbit Polyclonal beta COP Antibody [Alexa Fluor 488]

Ask
View Details
HSPA1L (Heat Shock 70kD Protein 1-like, HSP70-1L, HSP70-HOM, HSP70T, hum70t) (PE)
MBS6185844-01 0.1 mL

HSPA1L (Heat Shock 70kD Protein 1-like, HSP70-1L, HSP70-HOM, HSP70T, hum70t) (PE)

Ask
View Details
HSPA1L (Heat Shock 70kD Protein 1-like, HSP70-1L, HSP70-HOM, HSP70T, hum70t) (PE)
MBS6185844-02 5x 0.1 mL

HSPA1L (Heat Shock 70kD Protein 1-like, HSP70-1L, HSP70-HOM, HSP70T, hum70t) (PE)

Ask
View Details
EXD2 Human qPCR Primer Pair (NM_018199)
HP212911 200 Reactions

EXD2 Human qPCR Primer Pair (NM_018199)

Ask
View Details
Rabbit IgA (Immunoglobulin A) ELISA Kit
MBS8821499-01 48 Well

Rabbit IgA (Immunoglobulin A) ELISA Kit

Ask
View Details
Rabbit IgA (Immunoglobulin A) ELISA Kit
MBS8821499-02 96 Well

Rabbit IgA (Immunoglobulin A) ELISA Kit

Ask
View Details