Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCC-4/CCL16, Human

HCC-4/CCL16 Protein, Human is a CC chemokine that specifically attracts lymphocytes, dendritic cells and monocytes, increases their adhesion and has myelosuppressive activity. HCC-4/CCL16 Protein, Human interacts with CCR1, CCR2, CCR5 and CCR8 to mediate inflammatory and cancer responses. HCC-4/CCL16 Protein, Human is a recombinant human HCC-4/CCL16 (Q24-Q120) expressed by E. coli[1].

Product Specifications

Product Name Alternative

HCC-4/CCL16 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hcc-4-ccl16-protein-human.html

Purity

97.0

Smiles

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Molecular Formula

6360 (Gene_ID) O15467 (Q24-Q120) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Strasly M, et al. CCL16 activates an angiogenic program in vascular endothelial cells. Blood. 2004 Jan 1;103 (1) :40-9.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Jiahui Xu, et al. Silencing XIST mitigated lipopolysaccharide (LPS) -induced inflammatory injury in human lung fibroblast WI-38 cells through modulating miR-30b-5p/CCL16 axis and TLR4/NF-κB signaling pathway. Open Life Sci. 2021 Feb 6;16 (1) :108-127.|[4]In Sik Kim, et al. Differential CCR1-mediated chemotaxis signaling induced by human CC chemokine HCC-4/CCL16 in HOS cells. FEBS Lett. 2005 Nov 7;579 (27) :6044-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tcfl5 Pre-designed siRNA Set B
SI214311B 1 Each

Rat Tcfl5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cyclin E (MaxLight 550)
MBS6259568-01 0.1 mL

Cyclin E (MaxLight 550)

Sign In for Pricing
View Details
Cyclin E (MaxLight 550)
MBS6259568-02 5x 0.1 mL

Cyclin E (MaxLight 550)

Sign In for Pricing
View Details
Anti-Myoglobin Antibody
MBS9241196-01 0.05 mL

Anti-Myoglobin Antibody

Sign In for Pricing
View Details
Anti-Myoglobin Antibody
MBS9241196-02 0.1 mL

Anti-Myoglobin Antibody

Sign In for Pricing
View Details
Anti-Myoglobin Antibody
MBS9241196-03 5x 0.1 mL

Anti-Myoglobin Antibody

Sign In for Pricing
View Details