Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-21, Human (181a.a)

FGF-21 Protein, Human (181a.a), Human is an atypical member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

Product Specifications

Product Name Alternative

FGF-21 Protein, Human (181a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-21-protein-human-181aa.html

Purity

97.00

Smiles

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Molecular Formula

26291 (Gene_ID) Q9NSA1 (H29-S209) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 Class I Mouse Monoclonal Antibody [Clone ID: B-C34]
AM31235PU-N 2 mL (200 Tests)

CD34 Class I Mouse Monoclonal Antibody [Clone ID: B-C34]

Sign In for Pricing
View Details
2-(1-Naphthyl)-1-propanol-d3
TRC-N373157-25MG 25 mg

2-(1-Naphthyl)-1-propanol-d3

Sign In for Pricing
View Details
MCM2 Mouse Monoclonal Antibody [Clone ID: OTI1B1]
CF805784 100 µg

MCM2 Mouse Monoclonal Antibody [Clone ID: OTI1B1]

Sign In for Pricing
View Details
Abca7 Mouse Gene Knockout Kit (CRISPR)
KN500608 1 Kit

Abca7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Carboxypeptidase A2 (CPA2) (Center) Rabbit Polyclonal Antibody
AP51044PU-N 400 µL

Carboxypeptidase A2 (CPA2) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ALG11 Human Gene Knockout Kit (CRISPR)
KN418890 1 Kit

ALG11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details