Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-21, Human (181a.a)

FGF-21 Protein, Human (181a.a), Human is an atypical member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

Product Specifications

Product Name Alternative

FGF-21 Protein, Human (181a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-21-protein-human-181aa.html

Purity

97.00

Smiles

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Molecular Formula

26291 (Gene_ID) Q9NSA1 (H29-S209) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Natural Convection Oven BONC-5602
BONC-5602 1 Unit

Natural Convection Oven BONC-5602

Sign In for Pricing
View Details
GATM (NM_001482) Human Over-expression Lysate
LY419923 100 µg

GATM (NM_001482) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant BANF1 Antibody
RC-4151-01 50 μL

Recombinant BANF1 Antibody

Sign In for Pricing
View Details
Recombinant BANF1 Antibody
RC-4151-02 100 µL

Recombinant BANF1 Antibody

Sign In for Pricing
View Details
Recombinant BANF1 Antibody
RC-4151-03 1 mL

Recombinant BANF1 Antibody

Sign In for Pricing
View Details
FOXP1 Mouse Monoclonal Antibody [Clone ID: OTI2H3]
CF813710 100 µg

FOXP1 Mouse Monoclonal Antibody [Clone ID: OTI2H3]

Sign In for Pricing
View Details