Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-21, Human (181a.a)

FGF-21 Protein, Human (181a.a), Human is an atypical member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

Product Specifications

Product Name Alternative

FGF-21 Protein, Human (181a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-21-protein-human-181aa.html

Purity

97.00

Smiles

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Molecular Formula

26291 (Gene_ID) Q9NSA1 (H29-S209) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PTGR1, C-His Tag
HA210657-01 20 µg

Human PTGR1, C-His Tag

Sign In for Pricing
View Details
Human PTGR1, C-His Tag
HA210657-02 50 µg

Human PTGR1, C-His Tag

Sign In for Pricing
View Details
Human PTGR1, C-His Tag
HA210657-03 100 µg

Human PTGR1, C-His Tag

Sign In for Pricing
View Details
(S)-Norfenfluramine Hydrochloride
TRC-N680980-25MG 25 mg

(S)-Norfenfluramine Hydrochloride

Sign In for Pricing
View Details
Prolactin (PRL) ELISA Kit
K040-H1 1 Plate

Prolactin (PRL) ELISA Kit

Sign In for Pricing
View Details
4-Hydroxyanisole-d4
TRC-H750017-1G 1 g

4-Hydroxyanisole-d4

Sign In for Pricing
View Details