Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-21, Human (181a.a)

FGF-21 Protein, Human (181a.a), Human is an atypical member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

Product Specifications

Product Name Alternative

FGF-21 Protein, Human (181a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-21-protein-human-181aa.html

Purity

97.00

Smiles

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Molecular Formula

26291 (Gene_ID) Q9NSA1 (H29-S209) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klrk1 Mouse Gene Knockout Kit (CRISPR)
KN508948 1 Kit

Klrk1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
D-α-Hydrazino-α-methyl-β- (3,4-dihydroxyphenyl) propionic Acid (Mixture of Diasteromers)
445665-01 2.5 mg

D-α-Hydrazino-α-methyl-β- (3,4-dihydroxyphenyl) propionic Acid (Mixture of Diasteromers)

Sign In for Pricing
View Details
D-α-Hydrazino-α-methyl-β- (3,4-dihydroxyphenyl) propionic Acid (Mixture of Diasteromers)
445665-02 10 mg

D-α-Hydrazino-α-methyl-β- (3,4-dihydroxyphenyl) propionic Acid (Mixture of Diasteromers)

Sign In for Pricing
View Details
Human Neuropeptide W, NPW ELISA KIT
E7526Hu-01 48 Well

Human Neuropeptide W, NPW ELISA KIT

Sign In for Pricing
View Details
Human Neuropeptide W, NPW ELISA KIT
E7526Hu-02 96 Well

Human Neuropeptide W, NPW ELISA KIT

Sign In for Pricing
View Details
Human Neuropeptide W, NPW ELISA KIT
E7526Hu-03 5x 96 Tests

Human Neuropeptide W, NPW ELISA KIT

Sign In for Pricing
View Details