Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ), partial

Product Specifications

Product Name Alternative

Protein kinase C inhibitor protein 1 (KCIP-1)

Abbreviation

Recombinant Human YWHAZ protein, partial

Gene Name

YWHAZ

UniProt

P63104

Expression Region

133-212aa

Organism

Homo sapiens (Human)

Target Sequence

AAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYK

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.6 kDa

References & Citations

"ACBD3 interaction with TBC1 domain 22 protein is differentially affected by enteroviral and kobuviral 3A protein binding." Greninger A.L., Knudsen G.M., Betegon M., Burlingame A.L., DeRisi J.L. MBio 4:E00098-E00098 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal Rabbit anti-Goat IgG Fc fragment Secondary Antibody [DyLight 488]
NBP1-74853G 0.5 mL

Rabbit Polyclonal Rabbit anti-Goat IgG Fc fragment Secondary Antibody [DyLight 488]

Ask
View Details
Magic™ Membrane Protein Human ADCY3 (Adenylate cyclase 3) Full Length
MPC2459K Each

Magic™ Membrane Protein Human ADCY3 (Adenylate cyclase 3) Full Length

Ask
View Details
Rabbit Polyclonal CHES1 Antibody [Janelia Fluor 646]
NBP2-04051JF646 0.1 mL

Rabbit Polyclonal CHES1 Antibody [Janelia Fluor 646]

Ask
View Details
hCG beta protein
30-1131 100 ug

hCG beta protein

Ask
View Details
ENTPD3 (Ectonucleoside Triphosphate Diphosphohydrolase 3, NTPDase 3, CD39 Antigen-like 3, Ecto-ATP Diphosphohydrolase 3, Ecto-ATPDase 3, Ecto-ATPase 3, Ecto-apyrase 3, HB6, CD39L3) (MaxLight 650)
MBS6377423-01 0.1 mL

ENTPD3 (Ectonucleoside Triphosphate Diphosphohydrolase 3, NTPDase 3, CD39 Antigen-like 3, Ecto-ATP Diphosphohydrolase 3, Ecto-ATPDase 3, Ecto-ATPase 3, Ecto-apyrase 3, HB6, CD39L3) (MaxLight 650)

Ask
View Details
ENTPD3 (Ectonucleoside Triphosphate Diphosphohydrolase 3, NTPDase 3, CD39 Antigen-like 3, Ecto-ATP Diphosphohydrolase 3, Ecto-ATPDase 3, Ecto-ATPase 3, Ecto-apyrase 3, HB6, CD39L3) (MaxLight 650)
MBS6377423-02 5x 0.1 mL

ENTPD3 (Ectonucleoside Triphosphate Diphosphohydrolase 3, NTPDase 3, CD39 Antigen-like 3, Ecto-ATP Diphosphohydrolase 3, Ecto-ATPDase 3, Ecto-ATPase 3, Ecto-apyrase 3, HB6, CD39L3) (MaxLight 650)

Ask
View Details