Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Mouse

IL-3 Protein, Mouse (His) is a pleiotropic cytokine containing 135 amino acids, which functions via specific cell surface receptors to stimulate the proliferation, differentiation and survival of haematopoietic cell lines.

Product Specifications

Product Name Alternative

IL-3 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/recombinant-mouse-interleukin-3.html

Purity

98.00

Smiles

DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Formula

16187 (Gene_ID) P01586 (D33-C166) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZN781 rabbit pAb
E28PN3468 100 µL

ZN781 rabbit pAb

Sign In for Pricing
View Details
Pcsk2 Antibody
A30788-50UG 50 µg

Pcsk2 Antibody

Sign In for Pricing
View Details
LGR5/GPR49 Recombinant Antibody, Cy7 Conjugated
bsm-61052R-Cy7-01 20 µL

LGR5/GPR49 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
LGR5/GPR49 Recombinant Antibody, Cy7 Conjugated
bsm-61052R-Cy7-02 100 µL

LGR5/GPR49 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
STAT1 Antibody
A53195-100UL 100 µL

STAT1 Antibody

Sign In for Pricing
View Details
PTN Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-21929R-BF680 100 µL

PTN Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details