Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Rat (HEK293, His)

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (HEK293, His) is the recombinant rat-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SCF Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-rat-hek-293-his.html

Purity

95.0

Smiles

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)

Molecular Weight

Approximately 23-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRAS Antibody
A28819-100UL 100 µL

MRAS Antibody

Sign In for Pricing
View Details
PABPN1L, ID (PABPN1L, EPABP2, PABPNL1, Embryonic polyadenylate-binding protein 2, Embryonic poly (A) -binding protein type II, Poly (A) -binding protein nuclear-like 1) (AP) discontinued
039603-AP 200 µL

PABPN1L, ID (PABPN1L, EPABP2, PABPNL1, Embryonic polyadenylate-binding protein 2, Embryonic poly (A) -binding protein type II, Poly (A) -binding protein nuclear-like 1) (AP) discontinued

Sign In for Pricing
View Details
Guinea pig prostaglandin (PG) ELISA Kit
MBS2606077-01 48 Well

Guinea pig prostaglandin (PG) ELISA Kit

Sign In for Pricing
View Details
Guinea pig prostaglandin (PG) ELISA Kit
MBS2606077-02 96 Well

Guinea pig prostaglandin (PG) ELISA Kit

Sign In for Pricing
View Details
Guinea pig prostaglandin (PG) ELISA Kit
MBS2606077-03 5x 96 Well

Guinea pig prostaglandin (PG) ELISA Kit

Sign In for Pricing
View Details
Guinea pig prostaglandin (PG) ELISA Kit
MBS2606077-04 10x 96 Well

Guinea pig prostaglandin (PG) ELISA Kit

Sign In for Pricing
View Details