Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Rat (HEK293, His)

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (HEK293, His) is the recombinant rat-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SCF Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-rat-hek-293-his.html

Purity

95.0

Smiles

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)

Molecular Weight

Approximately 23-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC zeta (PRKCZ) Human shRNA Plasmid Kit (Locus ID 5590)
TR320477 1 Kit

PKC zeta (PRKCZ) Human shRNA Plasmid Kit (Locus ID 5590)

Sign In for Pricing
View Details
PAK1 (Serine/threonine-protein Kinase PAK 1, MGC130000, MGC130001, PAKalpha) (APC)
MBS6430435-01 0.1 mL

PAK1 (Serine/threonine-protein Kinase PAK 1, MGC130000, MGC130001, PAKalpha) (APC)

Sign In for Pricing
View Details
PAK1 (Serine/threonine-protein Kinase PAK 1, MGC130000, MGC130001, PAKalpha) (APC)
MBS6430435-02 5x 0.1 mL

PAK1 (Serine/threonine-protein Kinase PAK 1, MGC130000, MGC130001, PAKalpha) (APC)

Sign In for Pricing
View Details
Mouse Armadillo repeat-containing protein 2, Armc2 ELISA KIT
ELI-48952m 96 Tests

Mouse Armadillo repeat-containing protein 2, Armc2 ELISA KIT

Sign In for Pricing
View Details
Lentiviral human C1orf105 shRNA (UAS) - Lentiviral human C1orf105 shRNA (UAS, RFP) (25)
GTR15344138 1 Vial

Lentiviral human C1orf105 shRNA (UAS) - Lentiviral human C1orf105 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
ABL2 Antibody
A44792-50UL 50 μL

ABL2 Antibody

Sign In for Pricing
View Details