Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Rat (HEK293, His)

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (HEK293, His) is the recombinant rat-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SCF Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-rat-hek-293-his.html

Purity

95.0

Smiles

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)

Molecular Weight

Approximately 23-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HSV1 + HSV2 (gB) Monoclonal Antibody (Clone:T111)
30-1213-0.1 0.1 mg

Anti-HSV1 + HSV2 (gB) Monoclonal Antibody (Clone:T111)

Sign In for Pricing
View Details
Lentiviral mouse Ffar3 shRNA (UAS) - Lentiviral mouse Ffar3 shRNA (UAS, RFP) plasmid
GTR15304996 1 Vial

Lentiviral mouse Ffar3 shRNA (UAS) - Lentiviral mouse Ffar3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Human ZBTB9 activation kit by CRISPRa
GA116627 1 Kit

Human ZBTB9 activation kit by CRISPRa

Sign In for Pricing
View Details
MUM1 (IRF4) Rabbit Monoclonal Antibody
TA424175 100 µL

MUM1 (IRF4) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Robotic Station 96 Well Aluminum Rack
81006 1 Each

Robotic Station 96 Well Aluminum Rack

Sign In for Pricing
View Details
USP7-IN-14
HY-49319 1 Each

USP7-IN-14

Sign In for Pricing
View Details