Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Rat (HEK293, His)

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (HEK293, His) is the recombinant rat-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SCF Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-rat-hek-293-his.html

Purity

95.0

Smiles

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)

Molecular Weight

Approximately 23-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SART1 (NM_005146) Human Over-expression Lysate
LC417488 20 µg

SART1 (NM_005146) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Entpd5 (NM_001286058) AAV Particle
MR229849A1V 250 µL

Mouse Entpd5 (NM_001286058) AAV Particle

Sign In for Pricing
View Details
Chicken RNA-binding protein 45 (RBM45) ELISA Kit
NSL0087Ch 96 Tests

Chicken RNA-binding protein 45 (RBM45) ELISA Kit

Sign In for Pricing
View Details
Heat Shock Protein 90 Alpha (HSP90A) Antibody (ATTO594)
abx440877 200 µg

Heat Shock Protein 90 Alpha (HSP90A) Antibody (ATTO594)

Sign In for Pricing
View Details
Actinomycin D 50mg
A13239-50 50 mg

Actinomycin D 50mg

Sign In for Pricing
View Details
Cgref1 ORF Vector (Mouse) (pORF)
ORF041259 1.0 µg DNA

Cgref1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details