Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Rat (HEK293, His)

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (HEK293, His) is the recombinant rat-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SCF Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-rat-hek-293-his.html

Purity

95.0

Smiles

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)

Molecular Weight

Approximately 23-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tsr2 3'UTR GFP Stable Cell Line
TU272575 1.0 mL

Tsr2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Retinoic Acid Receptor gamma (RARG) Rabbit Polyclonal Antibody
TA371475 100 µL

Retinoic Acid Receptor gamma (RARG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Volumetric Sol Ammonium Sulphate 0.5M (1.0N) - 1L
AS2051 1 L

Volumetric Sol Ammonium Sulphate 0.5M (1.0N) - 1L

Sign In for Pricing
View Details
Research Grade Eptinezumab
MBS1563433-01 0.1 mg

Research Grade Eptinezumab

Sign In for Pricing
View Details
Research Grade Eptinezumab
MBS1563433-02 1 mg

Research Grade Eptinezumab

Sign In for Pricing
View Details
Research Grade Eptinezumab
MBS1563433-03 5x 1 mg

Research Grade Eptinezumab

Sign In for Pricing
View Details