Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Rat (HEK293, His)

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (HEK293, His) is the recombinant rat-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SCF Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-rat-hek-293-his.html

Purity

95.0

Smiles

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)

Molecular Weight

Approximately 23-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr44 Mouse qPCR Template Standard (NM_175180)
MK204483 1 Kit

Wdr44 Mouse qPCR Template Standard (NM_175180)

Sign In for Pricing
View Details
Rabbit anti-Drosophila erecta (Fruit fly) Manf Polyclonal Antibody
MBS7171058 Inquire

Rabbit anti-Drosophila erecta (Fruit fly) Manf Polyclonal Antibody

Sign In for Pricing
View Details
Human IL-10 / IL-2 Dual Fluorospot Set, 10 x 96-well (plates not included)
EA102037 10x 96 Well (Plates Not Included)

Human IL-10 / IL-2 Dual Fluorospot Set, 10 x 96-well (plates not included)

Sign In for Pricing
View Details
Mouse Monoclonal CCR5 Antibody (T21/8) [DyLight 680]
NBP1-43335FR 0.1 mL

Mouse Monoclonal CCR5 Antibody (T21/8) [DyLight 680]

Sign In for Pricing
View Details
Sesn2 (NM_001109358) Rat Tagged Lenti ORF Clone
RR210928L4 10 µg

Sesn2 (NM_001109358) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PARP10 Human shRNA Lentiviral Particle (Locus ID 84875)
TL302675V 500 µL Each

PARP10 Human shRNA Lentiviral Particle (Locus ID 84875)

Sign In for Pricing
View Details