Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Rat (HEK293, His)

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (HEK293, His) is the recombinant rat-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SCF Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-rat-hek-293-his.html

Purity

95.0

Smiles

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)

Molecular Weight

Approximately 23-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal FGF R1 Antibody (M19B2) [DyLight 488]
NB600-1287G 0.1 mL

Mouse Monoclonal FGF R1 Antibody (M19B2) [DyLight 488]

Sign In for Pricing
View Details
Human Forkhead box protein K1,FOXK1 ELISA KIT
JOT-EK7115Hu 96 wells

Human Forkhead box protein K1,FOXK1 ELISA KIT

Sign In for Pricing
View Details
Rdh7 Rat siRNA Oligo Duplex (Locus ID 360420)
SR503306 1 Kit

Rdh7 Rat siRNA Oligo Duplex (Locus ID 360420)

Sign In for Pricing
View Details
Mouse Ppp1r1a Pre-designed siRNA Set A
SI111021A 1 Each

Mouse Ppp1r1a Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human C-C Motif Chemokine 11/CCL11/Eotaxin
32-8163-50 50 µg

Recombinant Human C-C Motif Chemokine 11/CCL11/Eotaxin

Sign In for Pricing
View Details
RARB (HAP, NR1B2, Retinoic Acid Receptor beta, RAR-beta, HBV-activated Protein, Nuclear Receptor Subfamily 1 Group B Member 2, RAR-epsilon) (AP) discontinued
132319-AP 100 µL

RARB (HAP, NR1B2, Retinoic Acid Receptor beta, RAR-beta, HBV-activated Protein, Nuclear Receptor Subfamily 1 Group B Member 2, RAR-epsilon) (AP) discontinued

Sign In for Pricing
View Details