Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Rat (HEK293, His)

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (HEK293, His) is the recombinant rat-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SCF Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-rat-hek-293-his.html

Purity

95.0

Smiles

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)

Molecular Weight

Approximately 23-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trmt2a (NM_001080999) Mouse Tagged ORF Clone
MR225654 10 µg

Trmt2a (NM_001080999) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human carbonic anhydrase 2 (CA-2) ELISA Kit
QY-E01306 96 Tests

Human carbonic anhydrase 2 (CA-2) ELISA Kit

Sign In for Pricing
View Details
LOC683626 Protein Vector (Rat) (pPB-C-His)
PV279186 500 ng

LOC683626 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Anti-Human IgG (H+L)-AP
MBS674874-01 1 mL

Rabbit Anti-Human IgG (H+L)-AP

Sign In for Pricing
View Details
Rabbit Anti-Human IgG (H+L)-AP
MBS674874-02 5x 1 mL

Rabbit Anti-Human IgG (H+L)-AP

Sign In for Pricing
View Details
KLF4 (4Q18) Mouse Monoclonal Antibody
E28PB0726 100 µL

KLF4 (4Q18) Mouse Monoclonal Antibody

Sign In for Pricing
View Details