Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Rat (HEK293, His)

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (HEK293, His) is the recombinant rat-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SCF Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-rat-hek-293-his.html

Purity

95.0

Smiles

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)

Molecular Weight

Approximately 23-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IRF3 Antibody [Alexa Fluor 647]
NBP1-78769AF647 0.1 mL

Rabbit Polyclonal IRF3 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
H4c17 Mouse Gene Knockout Kit (CRISPR)
KN507781 1 Kit

H4c17 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Iars (NM_001100572) Rat Untagged Clone
RN206137 10 µg

Iars (NM_001100572) Rat Untagged Clone

Sign In for Pricing
View Details
Fish Phosphoinositide-3-Kinase Regulatory Subunit 2 (PIK3R2) ELISA Kit
MBS9919980 Inquire

Fish Phosphoinositide-3-Kinase Regulatory Subunit 2 (PIK3R2) ELISA Kit

Sign In for Pricing
View Details
Mfsd2a (NM_029662) Mouse Tagged Lenti ORF Clone
MR208553L4 10 µg

Mfsd2a (NM_029662) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ACTL9 Lentiviral Activation Particles (h2)
sc-415379-LAC-2 200 µL

ACTL9 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details