Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Feline

IL-10 Protein, a key immune regulator, mitigates inflammation by binding to its receptor (IL10RA/IL10RB), activating JAK1 and STAT2, leading to STAT3-mediated anti-inflammatory gene expression. IL-10 targets APCs, reducing pro-inflammatory cytokines and hindering antigen presentation. It controls macrophage inflammation through metabolic reprogramming. Existing as a homodimer, IL-10 interacts with IL10RA/IL10RB. IL-10 Protein, Feline is the recombinant IL-10 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-10 Protein, Feline, Cat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-feline.html

Purity

98.00

Smiles

SRHQSTLSEDNCTHFSVSLPHMLRELRAAFGKVKTFFQTKDELHSILLTRSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENEDPDIKQHVNSLGEKLKTLRLRLRRCHRFLPCENKSKVVEQVKSTFSKLQEKGVYKAMGEFDIFINYIEAYMTMKMKI

Molecular Formula

493683 (Gene_ID) P55029 (S19-I178) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), CF488A conjugate, 0.1mg/mL
BNC882166-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Anti-Mouse CD11a Antibody[I21/7]
AN00573D-01 50 Tests

PE Anti-Mouse CD11a Antibody[I21/7]

Sign In for Pricing
View Details
PE Anti-Mouse CD11a Antibody[I21/7]
AN00573D-02 100 Tests

PE Anti-Mouse CD11a Antibody[I21/7]

Sign In for Pricing
View Details
PE Anti-Mouse CD11a Antibody[I21/7]
AN00573D-03 2x 100 Tests

PE Anti-Mouse CD11a Antibody[I21/7]

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), Biotin conjugate, 0.1mg/mL
BNCB3247-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome b5 Polyclonal Antibody
E-AB-14924-01 20 µL

Cytochrome b5 Polyclonal Antibody

Sign In for Pricing
View Details