Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Feline

IL-10 Protein, a key immune regulator, mitigates inflammation by binding to its receptor (IL10RA/IL10RB), activating JAK1 and STAT2, leading to STAT3-mediated anti-inflammatory gene expression. IL-10 targets APCs, reducing pro-inflammatory cytokines and hindering antigen presentation. It controls macrophage inflammation through metabolic reprogramming. Existing as a homodimer, IL-10 interacts with IL10RA/IL10RB. IL-10 Protein, Feline is the recombinant IL-10 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-10 Protein, Feline, Cat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-feline.html

Purity

98.00

Smiles

SRHQSTLSEDNCTHFSVSLPHMLRELRAAFGKVKTFFQTKDELHSILLTRSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENEDPDIKQHVNSLGEKLKTLRLRLRRCHRFLPCENKSKVVEQVKSTFSKLQEKGVYKAMGEFDIFINYIEAYMTMKMKI

Molecular Formula

493683 (Gene_ID) P55029 (S19-I178) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OXSM Human Gene Knockout Kit (CRISPR)
KN401500 1 Kit

OXSM Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(3beta,9beta,10alpha)-3-Hydroxy-pregna-5,7-dien-20-one
TRC-H952275-2MG 2 mg

(3beta,9beta,10alpha)-3-Hydroxy-pregna-5,7-dien-20-one

Sign In for Pricing
View Details
Ethyl 2-Hydroxyphenylacetate
TRC-E919070-500MG 500 mg

Ethyl 2-Hydroxyphenylacetate

Sign In for Pricing
View Details
Zfp947 Mouse Gene Knockout Kit (CRISPR)
KN520042 1 Kit

Zfp947 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLK4 Antibody
8C11717-AAT 50 µg

CLK4 Antibody

Sign In for Pricing
View Details
TAZ / WWTR1 Recombinant Rabbit monoclonal Antibody
HA751569 100 µL

TAZ / WWTR1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details