Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Feline

IL-10 Protein, a key immune regulator, mitigates inflammation by binding to its receptor (IL10RA/IL10RB), activating JAK1 and STAT2, leading to STAT3-mediated anti-inflammatory gene expression. IL-10 targets APCs, reducing pro-inflammatory cytokines and hindering antigen presentation. It controls macrophage inflammation through metabolic reprogramming. Existing as a homodimer, IL-10 interacts with IL10RA/IL10RB. IL-10 Protein, Feline is the recombinant IL-10 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-10 Protein, Feline, Cat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-feline.html

Purity

98.00

Smiles

SRHQSTLSEDNCTHFSVSLPHMLRELRAAFGKVKTFFQTKDELHSILLTRSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENEDPDIKQHVNSLGEKLKTLRLRLRRCHRFLPCENKSKVVEQVKSTFSKLQEKGVYKAMGEFDIFINYIEAYMTMKMKI

Molecular Formula

493683 (Gene_ID) P55029 (S19-I178) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLAB (HLA-B) Rabbit Polyclonal Antibody
TA372496 100 µL

HLAB (HLA-B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PACAP receptor (ADCYAP1R1) Rabbit Polyclonal Antibody
TA360006 100 µL

PACAP receptor (ADCYAP1R1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant HSF1 (phospho S326) Antibody
RC-16617-01 50 μL

Recombinant HSF1 (phospho S326) Antibody

Sign In for Pricing
View Details
Recombinant HSF1 (phospho S326) Antibody
RC-16617-02 100 µL

Recombinant HSF1 (phospho S326) Antibody

Sign In for Pricing
View Details
Recombinant HSF1 (phospho S326) Antibody
RC-16617-03 1 mL

Recombinant HSF1 (phospho S326) Antibody

Sign In for Pricing
View Details
GBP1 Recombinant Rabbit Monoclonal Antibody [JE60-78]
HA720049 100 µL

GBP1 Recombinant Rabbit Monoclonal Antibody [JE60-78]

Sign In for Pricing
View Details