GH/Somatotropin, Mouse
GH/Somatotropin Protein, Mouse is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration, which can be used for the growth disorders research.
Product Specifications
Product Name Alternative
GH/Somatotropin Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gh-somatotropin-protein-mouse.html
Purity
98.0
Smiles
FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
Molecular Formula
14599 (Gene_ID) P06880 (F27-F216) (Accession)
Molecular Weight
Approximately 20.0-23 kDa
References & Citations
[1]Takeda A, et al. Recombinant human growth hormone for the treatment of growth disorders in children: a systematic review and economic evaluation. Health Technol Assess. 2010 Sep;14 (42) :1-209, iii-iv.|[2]Ranabir S, et al. Stress and hormones. Indian J Endocrinol Metab. 2011 Jan;15 (1) :18-22.|[3]Binder G, et al. "Noonan Syndrome: Genetics and Responsiveness to Growth Hormone Therapy". Horm Res. 67 (Supplement 1) : 45-49.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A09360-1-Fluoro647 100 µg/Vial
Anti-MGME1 Antibody Picoband® Fluoro647 Conjugated
Sign In for Pricing
View Details NBP3-26034AF488 0.1 mL
Rabbit Monoclonal Histone H2B [ac Lys5] Antibody (RM455) [Alexa Fluor 488]
Sign In for Pricing
View Details