Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDM2, Human

MDM2 protein is a key E3 ubiquitin protein ligase that coordinates cellular processes by ubiquitinating and degrading p53/TP53 and inhibiting its tumor suppressor function. In addition to p53/TP53 regulation, MDM2 inhibits p53/TP53- and p73/TP73-mediated responses, self-ubiquitinates, and targets ARRB1 for degradation. MDM2 Protein, Human is the recombinant human-derived MDM2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MDM2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdm2-protein-human.html

Purity

98.0

Smiles

SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN

Molecular Formula

4193 (Gene_ID) Q00987 (S17-N111) (Accession)

Molecular Weight

Approximately 11.1-12 KDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-BTBD7 antibody
STJ11100164 100 µl

Anti-BTBD7 antibody

Sign In for Pricing
View Details
Recombinant Human SRPK1 Protein (His & GST tag)
ARP6708-01 10 µg

Recombinant Human SRPK1 Protein (His & GST tag)

Sign In for Pricing
View Details
Recombinant Human SRPK1 Protein (His & GST tag)
ARP6708-02 50 µg

Recombinant Human SRPK1 Protein (His & GST tag)

Sign In for Pricing
View Details
Recombinant Human SRPK1 Protein (His & GST tag)
ARP6708-03 100 µg

Recombinant Human SRPK1 Protein (His & GST tag)

Sign In for Pricing
View Details
Recombinant Human SRPK1 Protein (His & GST tag)
ARP6708-04 1 mg

Recombinant Human SRPK1 Protein (His & GST tag)

Sign In for Pricing
View Details
RPLP1P2 ORF Vector (Human) (pORF)
ORF031140 1.0 µg DNA

RPLP1P2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details