Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDM2, Human

MDM2 protein is a key E3 ubiquitin protein ligase that coordinates cellular processes by ubiquitinating and degrading p53/TP53 and inhibiting its tumor suppressor function. In addition to p53/TP53 regulation, MDM2 inhibits p53/TP53- and p73/TP73-mediated responses, self-ubiquitinates, and targets ARRB1 for degradation. MDM2 Protein, Human is the recombinant human-derived MDM2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MDM2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdm2-protein-human.html

Purity

98.0

Smiles

SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN

Molecular Formula

4193 (Gene_ID) Q00987 (S17-N111) (Accession)

Molecular Weight

Approximately 11.1-12 KDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HERC5 Antibody, Biotin conjugated
A69934-100UG 100 µg

HERC5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse Adrenergic Receptor Beta 2 (ADRb2) ELISA Kit
MBS9308660-01 48 Well

Mouse Adrenergic Receptor Beta 2 (ADRb2) ELISA Kit

Sign In for Pricing
View Details
Mouse Adrenergic Receptor Beta 2 (ADRb2) ELISA Kit
MBS9308660-02 96 Well

Mouse Adrenergic Receptor Beta 2 (ADRb2) ELISA Kit

Sign In for Pricing
View Details
Mouse Adrenergic Receptor Beta 2 (ADRb2) ELISA Kit
MBS9308660-03 5x 96 Well

Mouse Adrenergic Receptor Beta 2 (ADRb2) ELISA Kit

Sign In for Pricing
View Details
Mouse Adrenergic Receptor Beta 2 (ADRb2) ELISA Kit
MBS9308660-04 10x 96 Well

Mouse Adrenergic Receptor Beta 2 (ADRb2) ELISA Kit

Sign In for Pricing
View Details
PDLIM5 Protein Vector (Mouse) (pPM-C-HA)
PV214840 500 ng

PDLIM5 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details