Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17RB, Rhesus Macaque (HEK293, His)

IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers[1][2]. IL-17RB Protein, Rhesus Macaque (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.

Product Specifications

Product Name Alternative

IL-17RB Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17rb-protein-rhesus-macaque-hek293-his.html

Purity

97.00

Smiles

REPTVQCGSETGPSPEWMLQHDLTPGDLRDLRVEPVKTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSLNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTSPLGNRYMALIQHSTIIGFSQVSEPYQNKQTRASVVIPVTEESEGAMVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNRSKPG

Molecular Formula

693671 (Gene_ID) G7ML21/EHH16291.1 (R18-G288) (Accession)

Molecular Weight

Approximately 40-50 kDa due to the glycosylation

References & Citations

[1]Lei Ren, et al. IL-17RB enhances thyroid cancer cell invasion and metastasis via ERK1/2 pathway-mediated MMP-9 expression. Mol Immunol. 2017 Oct;90:126-135.|[2]Y Shi, et al. A novel cytokine receptor-ligand pair. Identification, molecular characterization, and in vivo immunomodulatory activity. J Biol Chem. 2000 Jun 23;275 (25) :19167-76.|[3]Jérémy Bastid, et al. The Emerging Role of the IL-17B/IL-17RB Pathway in Cancer. Front Immunol. 2020 Apr 21;11:718.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog