Recombinant Chicken Indian hedgehog protein (IHH)

CGPGRVVGSRRRPPRKLIPLAYKQFSPNVPEKTLGASGRYEGKIARNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGMLARLAVEAGFDWVYYESKAHIHCSVKSEHSAAAKTGGCFPGRALATLENGARTPLWALRPGQRVLAMDGAGRPTYSDFLAFLDKEPRALTAFHVIETRQPPRRLALTPTHLLFVADNASAPAAQFRPTFASHVQPGHFVLVAVGSGGLQPAEVVGVRGRTDVGAYAPLTRHGTLVVDDVVASCFALVREQQLAQMAFWPLRLYHSLLGGPGVQGDGVHWYSGLLYRLGRMLLPPDSFHPLGAPRAES

[Indian hedgehog protein]: The C-terminal part of the indian hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein into two parts followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product. Both activities occur in the reticulum endoplasmic. ; [Indian hedgehog protein N-product]: The dually lipidated indian hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development. Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. Plays a role in morphogenesis of the skeleton by coordinating growth and differentiation of the endochondral skeleton. Positively regulates PTHLH expression during endochondral bone formation preventing chondrocyte hypertrophy. In contrast, participates in normal chondrocyte proliferation in a PTHLH-independent pathway.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

"Indian hedgehog and syndecans-3 coregulate chondrocyte proliferation and function during chick limb skeletogenesis." Shimo T., Gentili C., Iwamoto M., Wu C., Koyama E., Pacifici M. Dev Dyn 229:607-617 (2004)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.