Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRABP2, Human (His)

CRABP2 (cellular retinoic acid binding protein 2) plays a crucial role in cellular processes by transporting retinoic acid into the nucleus and mediating its contact with nuclear retinoic acid receptors. CRABP2 interacts with RXR (retinoic acid X receptor) and RARA (retinoic acid receptor Alpha) to regulate the retinoic acid signaling pathway. CRABP2 Protein, Human (His) is the recombinant human-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CRABP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crabp2-protein-human-his.html

Purity

95.00

Smiles

PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE

Molecular Formula

1382 (Gene_ID) P29373 (P2-E138) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P Glycoprotein (ABCB1) Human Gene Knockout Kit (CRISPR)
KN216080BN 1 Kit

P Glycoprotein (ABCB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B7]
TA803065AM 100 µL

Cytokeratin 7 (KRT7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B7]

Sign In for Pricing
View Details
Mix-n-StainTM Maxi CF®770 Antibody Labeling Kit, 1x1mg labeling
#92424 1 Kit

Mix-n-StainTM Maxi CF®770 Antibody Labeling Kit, 1x1mg labeling

Sign In for Pricing
View Details
(-)-Quinpirole Hydrochloride
TRC-Q796713-2.5MG 2.5 mg

(-)-Quinpirole Hydrochloride

Sign In for Pricing
View Details
TPM1 (NM_001018007) Human Over-expression Lysate
LY422690 100 µg

TPM1 (NM_001018007) Human Over-expression Lysate

Sign In for Pricing
View Details
CDPI3 Succinimidyl Ester [Minor Groove Binder SE]
6907-AAT 1 mg

CDPI3 Succinimidyl Ester [Minor Groove Binder SE]

Sign In for Pricing
View Details